Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RLP3

Protein Details
Accession G0RLP3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-70FIHWATFKPSQRKKKPDAAKGGKPGAHydrophilic
NLS Segment(s)
PositionSequence
54-70SQRKKKPDAAKGGKPGA
Subcellular Location(s) extr 11, cyto 8.5, cyto_nucl 5, mito 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG tre:TRIREDRAFT_34353  -  
Amino Acid Sequences GQFDWFKKIGATDEAVAVLNDQPYLFTVLVVVLVVLFAEGGLLYFIHWATFKPSQRKKKPDAAKGGKPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.13
5 0.11
6 0.08
7 0.08
8 0.07
9 0.06
10 0.07
11 0.1
12 0.09
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.11
37 0.18
38 0.25
39 0.35
40 0.45
41 0.56
42 0.66
43 0.75
44 0.77
45 0.8
46 0.84
47 0.83
48 0.85
49 0.83
50 0.82