Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RGP8

Protein Details
Accession G0RGP8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-129GHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
98-126KRRHGWLKRTRSKTGRRILQRRKLKGRRH
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tre:TRIREDRAFT_73231  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNSIIRLARPLLAPRIAPLSQRTYTCLSPLRPTLSSTFRPTTATSSSFTPSPTTTSSSEASADVVPATAVSAHPALQGMQLRFGPRNTMNGHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.29
4 0.28
5 0.28
6 0.3
7 0.3
8 0.31
9 0.33
10 0.31
11 0.31
12 0.33
13 0.34
14 0.3
15 0.31
16 0.34
17 0.35
18 0.32
19 0.33
20 0.33
21 0.34
22 0.36
23 0.37
24 0.35
25 0.31
26 0.33
27 0.32
28 0.31
29 0.28
30 0.26
31 0.21
32 0.21
33 0.22
34 0.2
35 0.2
36 0.17
37 0.15
38 0.16
39 0.16
40 0.17
41 0.17
42 0.19
43 0.19
44 0.18
45 0.18
46 0.15
47 0.15
48 0.11
49 0.1
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.06
63 0.08
64 0.12
65 0.11
66 0.13
67 0.14
68 0.15
69 0.17
70 0.17
71 0.2
72 0.17
73 0.22
74 0.23
75 0.28
76 0.29
77 0.31
78 0.32
79 0.31
80 0.38
81 0.42
82 0.46
83 0.47
84 0.51
85 0.57
86 0.65
87 0.72
88 0.71
89 0.73
90 0.77
91 0.81
92 0.83
93 0.82
94 0.82
95 0.82
96 0.84
97 0.84
98 0.83
99 0.82
100 0.83
101 0.87
102 0.88
103 0.89
104 0.89
105 0.9
106 0.91
107 0.91
108 0.9
109 0.9