Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0R8J5

Protein Details
Accession G0R8J5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
130-154RTAPAPQPIRGRRKPPRCRLAFVSAHydrophilic
NLS Segment(s)
PositionSequence
62-72GKGRRSARRRK
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, mito 5
Family & Domain DBs
KEGG tre:TRIREDRAFT_102884  -  
Amino Acid Sequences MDVADRRSSSKPPSDGLPCKHAIIDGEEAVIGPRTAGNGDILCVFGVYKTGTMRAKADAISGKGRRSARRRKTVGDCSITFVIFCLVGQGSAALQPQARPGLAAVGSPLGTTLPVLGLGNWPLVQQLQLRTAPAPQPIRGRRKPPRCRLAFVSASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.55
4 0.54
5 0.48
6 0.46
7 0.44
8 0.38
9 0.3
10 0.26
11 0.24
12 0.18
13 0.16
14 0.15
15 0.14
16 0.14
17 0.13
18 0.09
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.08
25 0.07
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.12
38 0.13
39 0.15
40 0.16
41 0.16
42 0.17
43 0.16
44 0.18
45 0.16
46 0.17
47 0.23
48 0.23
49 0.23
50 0.27
51 0.31
52 0.36
53 0.43
54 0.51
55 0.54
56 0.62
57 0.65
58 0.66
59 0.71
60 0.73
61 0.7
62 0.64
63 0.55
64 0.48
65 0.45
66 0.38
67 0.29
68 0.2
69 0.14
70 0.08
71 0.08
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.08
84 0.09
85 0.08
86 0.08
87 0.08
88 0.09
89 0.09
90 0.09
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.05
97 0.04
98 0.04
99 0.04
100 0.03
101 0.04
102 0.05
103 0.05
104 0.06
105 0.07
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.1
112 0.11
113 0.13
114 0.17
115 0.18
116 0.2
117 0.2
118 0.23
119 0.25
120 0.29
121 0.3
122 0.3
123 0.39
124 0.47
125 0.57
126 0.62
127 0.69
128 0.72
129 0.8
130 0.86
131 0.87
132 0.89
133 0.85
134 0.84
135 0.81
136 0.79