Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RX00

Protein Details
Accession G0RX00    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-27SSQHNQSRKAHRNGIKKPKTSHydrophilic
NLS Segment(s)
PositionSequence
14-55RKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tre:TRIREDRAFT_52763  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKAAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.78
6 0.79
7 0.82
8 0.8
9 0.78
10 0.78
11 0.77
12 0.78
13 0.75
14 0.74
15 0.71
16 0.68
17 0.66
18 0.63
19 0.6
20 0.57
21 0.55
22 0.56
23 0.52
24 0.55
25 0.59
26 0.64
27 0.68
28 0.68
29 0.75
30 0.68
31 0.74
32 0.68
33 0.68
34 0.67
35 0.61
36 0.57
37 0.52
38 0.48
39 0.42