Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RFH2

Protein Details
Accession G0RFH2   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
200-220EASKSKSKPKPKTGSSRPLKSHydrophilic
228-247LVRHREEKERERRMRRELDEBasic
NLS Segment(s)
PositionSequence
203-242KSKSKPKPKTGSSRPLKSVPVLYRGLVRHREEKERERRMR
Subcellular Location(s) nucl 20, cyto 5.5, cyto_pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025239  DUF4187  
IPR000467  G_patch_dom  
IPR039249  GPATCH11  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG tre:TRIREDRAFT_105650  -  
Pfam View protein in Pfam  
PF13821  DUF4187  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MSPQDAQDDEDDYMNMTFQDAPPTTESSVQRAERLKRESRARGIIKSKAQLAQEEAAAREKALATSLLEDARAKKSKGLAMMAKMGFKGGGLGKKTEDGQGSGKTEPIRISMKEDRGGIGMESEKKRKLQEAAEERDVKAVKIDPLEYRERMRAEREDARLEAQLRAAQRTAERLDEEKTSTELSQKYPPPSSSPSSEEEASKSKSKPKPKTGSSRPLKSVPVLYRGLVRHREEKERERRMRRELDESLSRLPTYETSDEDDDDKMAMGKDVTFALADDSDEEDEELQEFEALDLKTRLARLVMYLREKHRYCFWCKMAYPDDEMDGCPGITEEDHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.1
4 0.1
5 0.1
6 0.18
7 0.17
8 0.2
9 0.22
10 0.26
11 0.26
12 0.31
13 0.32
14 0.29
15 0.36
16 0.35
17 0.38
18 0.42
19 0.48
20 0.5
21 0.56
22 0.58
23 0.59
24 0.67
25 0.7
26 0.71
27 0.73
28 0.7
29 0.71
30 0.7
31 0.69
32 0.66
33 0.62
34 0.58
35 0.53
36 0.49
37 0.43
38 0.41
39 0.35
40 0.31
41 0.28
42 0.25
43 0.24
44 0.22
45 0.2
46 0.17
47 0.15
48 0.13
49 0.13
50 0.12
51 0.09
52 0.11
53 0.13
54 0.12
55 0.12
56 0.14
57 0.16
58 0.22
59 0.26
60 0.25
61 0.26
62 0.3
63 0.33
64 0.35
65 0.38
66 0.34
67 0.33
68 0.39
69 0.37
70 0.33
71 0.3
72 0.26
73 0.2
74 0.16
75 0.15
76 0.12
77 0.16
78 0.17
79 0.18
80 0.19
81 0.21
82 0.22
83 0.22
84 0.2
85 0.18
86 0.19
87 0.22
88 0.24
89 0.22
90 0.24
91 0.21
92 0.22
93 0.2
94 0.21
95 0.2
96 0.18
97 0.25
98 0.29
99 0.32
100 0.33
101 0.33
102 0.3
103 0.27
104 0.27
105 0.19
106 0.14
107 0.13
108 0.17
109 0.2
110 0.22
111 0.24
112 0.26
113 0.27
114 0.29
115 0.31
116 0.3
117 0.36
118 0.42
119 0.46
120 0.5
121 0.5
122 0.47
123 0.46
124 0.42
125 0.32
126 0.24
127 0.2
128 0.15
129 0.15
130 0.16
131 0.14
132 0.18
133 0.22
134 0.22
135 0.22
136 0.24
137 0.25
138 0.25
139 0.27
140 0.25
141 0.27
142 0.31
143 0.32
144 0.3
145 0.29
146 0.29
147 0.27
148 0.26
149 0.21
150 0.15
151 0.15
152 0.13
153 0.14
154 0.13
155 0.11
156 0.11
157 0.14
158 0.14
159 0.13
160 0.13
161 0.14
162 0.15
163 0.16
164 0.16
165 0.14
166 0.13
167 0.13
168 0.12
169 0.15
170 0.15
171 0.16
172 0.21
173 0.24
174 0.27
175 0.28
176 0.29
177 0.29
178 0.32
179 0.32
180 0.3
181 0.29
182 0.29
183 0.29
184 0.29
185 0.26
186 0.24
187 0.25
188 0.25
189 0.26
190 0.24
191 0.31
192 0.37
193 0.46
194 0.53
195 0.6
196 0.66
197 0.7
198 0.79
199 0.8
200 0.84
201 0.82
202 0.79
203 0.73
204 0.67
205 0.61
206 0.52
207 0.5
208 0.41
209 0.38
210 0.32
211 0.29
212 0.3
213 0.3
214 0.34
215 0.34
216 0.35
217 0.37
218 0.4
219 0.49
220 0.5
221 0.59
222 0.63
223 0.67
224 0.74
225 0.75
226 0.78
227 0.78
228 0.8
229 0.74
230 0.71
231 0.64
232 0.61
233 0.57
234 0.53
235 0.48
236 0.4
237 0.36
238 0.28
239 0.26
240 0.21
241 0.21
242 0.2
243 0.18
244 0.21
245 0.22
246 0.23
247 0.23
248 0.22
249 0.16
250 0.15
251 0.13
252 0.1
253 0.09
254 0.08
255 0.08
256 0.07
257 0.08
258 0.08
259 0.08
260 0.07
261 0.07
262 0.08
263 0.08
264 0.08
265 0.08
266 0.1
267 0.1
268 0.1
269 0.1
270 0.09
271 0.09
272 0.09
273 0.08
274 0.07
275 0.07
276 0.06
277 0.06
278 0.11
279 0.11
280 0.13
281 0.13
282 0.14
283 0.16
284 0.16
285 0.17
286 0.13
287 0.14
288 0.16
289 0.23
290 0.29
291 0.34
292 0.4
293 0.44
294 0.53
295 0.54
296 0.53
297 0.56
298 0.55
299 0.56
300 0.59
301 0.59
302 0.58
303 0.58
304 0.63
305 0.59
306 0.56
307 0.54
308 0.45
309 0.43
310 0.35
311 0.35
312 0.28
313 0.23
314 0.19
315 0.14
316 0.13
317 0.11