Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RIL8

Protein Details
Accession G0RIL8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
62-84QSQGGEEKKKKKKEPPYRQGSGTBasic
NLS Segment(s)
PositionSequence
69-76KKKKKKEP
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
KEGG tre:TRIREDRAFT_107141  -  
Amino Acid Sequences RRREFDASRTDKWPDPWQAMGINASRPACSPIVPIQSFAIQPPRKVTSEEIEDEPAEAQQVQSQGGEEKKKKKKEPPYRQGSGTAKQHGMSDMIDLPAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.42
4 0.4
5 0.37
6 0.34
7 0.32
8 0.25
9 0.21
10 0.21
11 0.2
12 0.18
13 0.17
14 0.19
15 0.16
16 0.15
17 0.16
18 0.18
19 0.25
20 0.25
21 0.25
22 0.23
23 0.24
24 0.24
25 0.22
26 0.27
27 0.2
28 0.21
29 0.24
30 0.26
31 0.25
32 0.27
33 0.28
34 0.22
35 0.25
36 0.26
37 0.23
38 0.21
39 0.2
40 0.19
41 0.16
42 0.12
43 0.09
44 0.06
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.1
52 0.14
53 0.22
54 0.26
55 0.35
56 0.44
57 0.53
58 0.61
59 0.68
60 0.76
61 0.8
62 0.85
63 0.86
64 0.87
65 0.83
66 0.78
67 0.77
68 0.71
69 0.68
70 0.63
71 0.58
72 0.5
73 0.45
74 0.44
75 0.36
76 0.32
77 0.24
78 0.2
79 0.16