Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HAD9

Protein Details
Accession Q2HAD9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
104-128PSVARRPHPPRPRCPPPPKRPGKVGBasic
NLS Segment(s)
PositionSequence
101-131PAGPSVARRPHPPRPRCPPPPKRPGKVGGPP
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MLSSRHVPVRVAVHDQEIYEWGIPAHPGISSERPPSISKSFKSQIERVHLETTPTYKHSQTIKPPTSTTPNPFPDQQKPLPPQRRRWATSAAASAIPSRSPAGPSVARRPHPPRPRCPPPPKRPGKVGGPPRTLGGNSTPGSGSTAADDARARAAAAAEERLQKSKQGGKLKAQLNQQRGMTDAQALREASETEQRQRELDQSASALRHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.29
4 0.24
5 0.22
6 0.17
7 0.15
8 0.11
9 0.11
10 0.11
11 0.1
12 0.09
13 0.07
14 0.08
15 0.12
16 0.17
17 0.21
18 0.24
19 0.25
20 0.28
21 0.29
22 0.34
23 0.37
24 0.38
25 0.36
26 0.42
27 0.45
28 0.49
29 0.54
30 0.53
31 0.52
32 0.54
33 0.56
34 0.51
35 0.49
36 0.43
37 0.38
38 0.36
39 0.31
40 0.26
41 0.25
42 0.24
43 0.21
44 0.26
45 0.29
46 0.34
47 0.41
48 0.49
49 0.51
50 0.51
51 0.52
52 0.51
53 0.53
54 0.51
55 0.47
56 0.45
57 0.43
58 0.43
59 0.46
60 0.47
61 0.46
62 0.48
63 0.46
64 0.45
65 0.47
66 0.54
67 0.61
68 0.62
69 0.64
70 0.67
71 0.72
72 0.68
73 0.66
74 0.62
75 0.54
76 0.52
77 0.45
78 0.36
79 0.28
80 0.25
81 0.22
82 0.16
83 0.13
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.11
90 0.15
91 0.17
92 0.25
93 0.29
94 0.3
95 0.36
96 0.41
97 0.47
98 0.54
99 0.59
100 0.59
101 0.63
102 0.71
103 0.76
104 0.81
105 0.82
106 0.82
107 0.86
108 0.86
109 0.81
110 0.77
111 0.72
112 0.69
113 0.67
114 0.67
115 0.65
116 0.59
117 0.55
118 0.5
119 0.46
120 0.38
121 0.31
122 0.23
123 0.21
124 0.18
125 0.18
126 0.17
127 0.16
128 0.18
129 0.17
130 0.14
131 0.09
132 0.1
133 0.09
134 0.1
135 0.1
136 0.09
137 0.09
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.11
145 0.12
146 0.17
147 0.18
148 0.21
149 0.21
150 0.22
151 0.27
152 0.32
153 0.37
154 0.42
155 0.46
156 0.51
157 0.59
158 0.62
159 0.62
160 0.64
161 0.64
162 0.59
163 0.59
164 0.52
165 0.44
166 0.42
167 0.38
168 0.29
169 0.27
170 0.24
171 0.21
172 0.23
173 0.22
174 0.21
175 0.2
176 0.2
177 0.17
178 0.24
179 0.26
180 0.3
181 0.36
182 0.36
183 0.36
184 0.37
185 0.39
186 0.35
187 0.33
188 0.28
189 0.25
190 0.28