Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RA92

Protein Details
Accession G0RA92    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-63DGKSFRFCRSKCNRNYKMKRNPRKLKWTKAYRRNAGKEMHydrophilic
NLS Segment(s)
PositionSequence
42-56MKRNPRKLKWTKAYR
98-125EIRARRERVFYKKRMAGKRERELAAARK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0001671  F:ATPase activator activity  
GO:0051117  F:ATPase binding  
GO:1902626  P:assembly of large subunit precursor of preribosome  
GO:0032781  P:positive regulation of ATP-dependent activity  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG tre:TRIREDRAFT_120260  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEDCSFCGRPAYPSKGITFVRNDGKSFRFCRSKCNRNYKMKRNPRKLKWTKAYRRNAGKEMTVDSTLQFAARRNEPVRYDRDLAAKTLAAIKRVSEIRARRERVFYKKRMAGKRERELAAARKLVAENEHLLPRLRGSEKKRLAELAAERGEDVVVEEEEQMLLATRKNAVKAFGGEQRRVKVRVDGGVEEEIVRTIREEVDEEDDDEDVDMED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.42
4 0.47
5 0.47
6 0.46
7 0.43
8 0.42
9 0.46
10 0.45
11 0.44
12 0.42
13 0.44
14 0.46
15 0.45
16 0.46
17 0.47
18 0.45
19 0.54
20 0.6
21 0.66
22 0.69
23 0.77
24 0.79
25 0.8
26 0.9
27 0.9
28 0.91
29 0.92
30 0.93
31 0.93
32 0.94
33 0.92
34 0.93
35 0.92
36 0.91
37 0.91
38 0.91
39 0.9
40 0.9
41 0.9
42 0.88
43 0.89
44 0.84
45 0.78
46 0.7
47 0.62
48 0.53
49 0.46
50 0.4
51 0.31
52 0.25
53 0.2
54 0.18
55 0.15
56 0.14
57 0.11
58 0.12
59 0.15
60 0.17
61 0.22
62 0.23
63 0.27
64 0.3
65 0.33
66 0.35
67 0.36
68 0.37
69 0.33
70 0.37
71 0.33
72 0.3
73 0.27
74 0.22
75 0.17
76 0.2
77 0.19
78 0.15
79 0.15
80 0.14
81 0.17
82 0.18
83 0.19
84 0.19
85 0.23
86 0.3
87 0.39
88 0.42
89 0.4
90 0.46
91 0.5
92 0.55
93 0.59
94 0.55
95 0.54
96 0.56
97 0.62
98 0.63
99 0.63
100 0.63
101 0.63
102 0.66
103 0.64
104 0.59
105 0.53
106 0.49
107 0.49
108 0.44
109 0.35
110 0.28
111 0.23
112 0.23
113 0.21
114 0.19
115 0.15
116 0.13
117 0.14
118 0.15
119 0.14
120 0.15
121 0.14
122 0.14
123 0.16
124 0.17
125 0.22
126 0.27
127 0.36
128 0.43
129 0.45
130 0.46
131 0.43
132 0.41
133 0.4
134 0.36
135 0.33
136 0.28
137 0.25
138 0.24
139 0.22
140 0.21
141 0.15
142 0.13
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.11
156 0.13
157 0.16
158 0.17
159 0.18
160 0.2
161 0.22
162 0.26
163 0.3
164 0.33
165 0.36
166 0.4
167 0.43
168 0.46
169 0.45
170 0.42
171 0.41
172 0.4
173 0.4
174 0.4
175 0.36
176 0.34
177 0.33
178 0.32
179 0.25
180 0.22
181 0.17
182 0.13
183 0.12
184 0.09
185 0.09
186 0.1
187 0.11
188 0.13
189 0.15
190 0.21
191 0.22
192 0.22
193 0.21
194 0.2
195 0.19
196 0.17