Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RVE3

Protein Details
Accession G0RVE3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPPRPAPKNAIKPPPHRKRIIVHydrophilic
NLS Segment(s)
PositionSequence
7-20APKNAIKPPPHRKR
Subcellular Location(s) mito 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036551  Flavin_trans-like  
IPR003382  Flavoprotein  
IPR004507  UbiX-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004659  F:prenyltransferase activity  
KEGG tre:TRIREDRAFT_72549  -  
Pfam View protein in Pfam  
PF02441  Flavoprotein  
Amino Acid Sequences MAPPRPAPKNAIKPPPHRKRIIVAMTGASGAILGVRVLMALRHLNVETHLIMSKWARHTIDSEVIGWDSTKLHNYAQHVYDIDDMEARIASGSFRVDGMIVVPCSMKTLAAIYNGLCDNVITRAADVCLKERRRLVLVTRETPLSEIHLRNMLGVTRAGAVVFPPCAGVLHRGDFGGRSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.86
4 0.81
5 0.76
6 0.72
7 0.74
8 0.7
9 0.62
10 0.53
11 0.46
12 0.41
13 0.37
14 0.29
15 0.19
16 0.11
17 0.07
18 0.05
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.06
27 0.07
28 0.08
29 0.09
30 0.1
31 0.1
32 0.11
33 0.14
34 0.12
35 0.12
36 0.12
37 0.1
38 0.12
39 0.13
40 0.17
41 0.17
42 0.21
43 0.2
44 0.21
45 0.23
46 0.25
47 0.28
48 0.24
49 0.22
50 0.18
51 0.18
52 0.17
53 0.15
54 0.11
55 0.08
56 0.07
57 0.09
58 0.09
59 0.1
60 0.13
61 0.16
62 0.18
63 0.19
64 0.19
65 0.18
66 0.17
67 0.18
68 0.16
69 0.13
70 0.1
71 0.08
72 0.07
73 0.07
74 0.06
75 0.04
76 0.04
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.05
95 0.07
96 0.08
97 0.09
98 0.1
99 0.08
100 0.11
101 0.11
102 0.11
103 0.09
104 0.08
105 0.07
106 0.08
107 0.09
108 0.06
109 0.07
110 0.07
111 0.08
112 0.1
113 0.1
114 0.14
115 0.22
116 0.24
117 0.28
118 0.3
119 0.33
120 0.34
121 0.36
122 0.38
123 0.39
124 0.43
125 0.42
126 0.42
127 0.39
128 0.36
129 0.34
130 0.29
131 0.24
132 0.24
133 0.21
134 0.22
135 0.25
136 0.25
137 0.24
138 0.25
139 0.21
140 0.16
141 0.15
142 0.14
143 0.11
144 0.11
145 0.1
146 0.09
147 0.09
148 0.09
149 0.09
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1
155 0.15
156 0.16
157 0.19
158 0.2
159 0.2
160 0.2
161 0.2