Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0REJ0

Protein Details
Accession G0REJ0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-29AAKKHVPIVKKHKTRFARHQSDRFDRVBasic
NLS Segment(s)
PositionSequence
10-55IVKKHKTRFARHQSDRFDRVGESWRKPKGIDGRVRRRFRGTIRMPK
Subcellular Location(s) mito 16, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tre:TRIREDRAFT_21890  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHKTRFARHQSDRFDRVGESWRKPKGIDGRVRRRFRGTIRMPKIGYGSNKKTRFLTPSGHKAFLVHNVKDLELLLMHNRTHAAEIASAVSSRKRIDIISRAKQIGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.82
4 0.83
5 0.83
6 0.83
7 0.83
8 0.86
9 0.85
10 0.84
11 0.79
12 0.69
13 0.59
14 0.48
15 0.42
16 0.43
17 0.4
18 0.39
19 0.42
20 0.44
21 0.44
22 0.43
23 0.48
24 0.48
25 0.5
26 0.53
27 0.56
28 0.63
29 0.72
30 0.76
31 0.72
32 0.67
33 0.63
34 0.59
35 0.59
36 0.57
37 0.58
38 0.59
39 0.62
40 0.57
41 0.53
42 0.5
43 0.43
44 0.4
45 0.37
46 0.39
47 0.42
48 0.44
49 0.44
50 0.44
51 0.42
52 0.4
53 0.36
54 0.35
55 0.32
56 0.4
57 0.42
58 0.41
59 0.38
60 0.35
61 0.33
62 0.35
63 0.35
64 0.25
65 0.26
66 0.26
67 0.26
68 0.25
69 0.24
70 0.15
71 0.09
72 0.1
73 0.09
74 0.1
75 0.1
76 0.11
77 0.11
78 0.11
79 0.12
80 0.12
81 0.11
82 0.09
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.11
89 0.12
90 0.12
91 0.13
92 0.13
93 0.14
94 0.21
95 0.3
96 0.38
97 0.44
98 0.5
99 0.49
100 0.49
101 0.5
102 0.45
103 0.45
104 0.38
105 0.35
106 0.35
107 0.39
108 0.45
109 0.43
110 0.43
111 0.37