Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RA97

Protein Details
Accession G0RA97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65IFLSRNQKTRNQFRPRAGKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Gene Ontology GO:0005935  C:cellular bud neck  
GO:0031097  C:medial cortex  
GO:0071958  C:new mitotic spindle pole body  
GO:0071957  C:old mitotic spindle pole body  
GO:1902554  C:serine/threonine protein kinase complex  
GO:0034973  C:Sid2-Mob1 complex  
GO:0030295  F:protein kinase activator activity  
GO:0000281  P:mitotic cytokinesis  
GO:1903473  P:positive regulation of mitotic actomyosin contractile ring contraction  
GO:0031031  P:positive regulation of septation initiation signaling  
GO:0008104  P:protein localization  
GO:0006468  P:protein phosphorylation  
GO:0007096  P:regulation of exit from mitosis  
KEGG tre:TRIREDRAFT_55208  -  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MAFALFQYLSPRSRAKIARQDGTILPVYEDPPLKPVLNTVIADGEIFLSRNQKTRNQFRPRAGKGGVNSYQLRQYAEVTLGGGSLRKVVKLPEGEDENEWLAVNMVDFYNQINLLYGAITEFCSPQSCPEMKATDEFEYLWQDNENYKRPTKMAAPAYIEQLMTWVQANIDNESVMPSKIGVPFPKSFPALIRQIFKRMYRVYAHIYCHHYPVIRELGLEPHLNTSFKQYVLFIDEHSLASGRDYWGPLGDLVDSMLKSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.52
4 0.58
5 0.6
6 0.58
7 0.6
8 0.53
9 0.51
10 0.45
11 0.34
12 0.28
13 0.23
14 0.22
15 0.22
16 0.23
17 0.18
18 0.18
19 0.2
20 0.19
21 0.18
22 0.19
23 0.2
24 0.23
25 0.23
26 0.21
27 0.19
28 0.18
29 0.18
30 0.16
31 0.12
32 0.08
33 0.09
34 0.09
35 0.13
36 0.14
37 0.21
38 0.24
39 0.31
40 0.4
41 0.49
42 0.59
43 0.65
44 0.71
45 0.74
46 0.81
47 0.78
48 0.76
49 0.67
50 0.61
51 0.53
52 0.54
53 0.48
54 0.43
55 0.39
56 0.34
57 0.36
58 0.32
59 0.31
60 0.23
61 0.21
62 0.17
63 0.17
64 0.16
65 0.12
66 0.11
67 0.09
68 0.08
69 0.07
70 0.06
71 0.09
72 0.09
73 0.09
74 0.1
75 0.11
76 0.16
77 0.18
78 0.19
79 0.2
80 0.22
81 0.23
82 0.23
83 0.24
84 0.19
85 0.17
86 0.15
87 0.1
88 0.08
89 0.06
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.07
112 0.08
113 0.13
114 0.12
115 0.14
116 0.16
117 0.17
118 0.17
119 0.19
120 0.2
121 0.16
122 0.16
123 0.15
124 0.13
125 0.15
126 0.14
127 0.13
128 0.1
129 0.1
130 0.13
131 0.17
132 0.22
133 0.22
134 0.23
135 0.24
136 0.25
137 0.27
138 0.27
139 0.3
140 0.29
141 0.3
142 0.33
143 0.32
144 0.34
145 0.32
146 0.29
147 0.21
148 0.17
149 0.13
150 0.09
151 0.08
152 0.06
153 0.06
154 0.08
155 0.1
156 0.1
157 0.1
158 0.09
159 0.09
160 0.11
161 0.12
162 0.09
163 0.08
164 0.07
165 0.1
166 0.12
167 0.15
168 0.15
169 0.2
170 0.22
171 0.25
172 0.28
173 0.26
174 0.24
175 0.24
176 0.27
177 0.29
178 0.3
179 0.33
180 0.32
181 0.37
182 0.41
183 0.41
184 0.42
185 0.38
186 0.39
187 0.36
188 0.39
189 0.4
190 0.41
191 0.44
192 0.42
193 0.47
194 0.44
195 0.43
196 0.41
197 0.35
198 0.3
199 0.31
200 0.31
201 0.24
202 0.23
203 0.22
204 0.24
205 0.25
206 0.25
207 0.21
208 0.2
209 0.22
210 0.22
211 0.21
212 0.25
213 0.24
214 0.24
215 0.24
216 0.2
217 0.2
218 0.24
219 0.24
220 0.17
221 0.19
222 0.19
223 0.18
224 0.19
225 0.17
226 0.13
227 0.14
228 0.15
229 0.13
230 0.15
231 0.16
232 0.16
233 0.17
234 0.18
235 0.17
236 0.16
237 0.14
238 0.11
239 0.11
240 0.13