Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RMG0

Protein Details
Accession G0RMG0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-32LYRQCLRECRKKPQDTRAHFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
KEGG tre:TRIREDRAFT_108481  -  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MRLSGLQKEVLALYRQCLRECRKKPQDTRAHFEKFVRAEFSRNITIEKRDFAAIEFLLRKGHRQLDVYSSPGIKDIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.32
5 0.37
6 0.44
7 0.5
8 0.58
9 0.62
10 0.7
11 0.76
12 0.79
13 0.82
14 0.78
15 0.79
16 0.76
17 0.7
18 0.62
19 0.55
20 0.5
21 0.41
22 0.36
23 0.33
24 0.25
25 0.23
26 0.23
27 0.26
28 0.23
29 0.22
30 0.23
31 0.2
32 0.24
33 0.23
34 0.22
35 0.2
36 0.17
37 0.17
38 0.15
39 0.17
40 0.13
41 0.15
42 0.15
43 0.14
44 0.18
45 0.18
46 0.2
47 0.22
48 0.27
49 0.27
50 0.29
51 0.31
52 0.35
53 0.38
54 0.38
55 0.36
56 0.31
57 0.28