Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RSG2

Protein Details
Accession G0RSG2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
325-354GNYGAKPAVLPRKKKKKKKIANGSGREETGHydrophilic
NLS Segment(s)
PositionSequence
334-346LPRKKKKKKKIAN
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, cyto 8, cyto_mito 5.333, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004600  TFIIH_Tfb4/GTF2H3  
IPR036465  vWFA_dom_sf  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG tre:TRIREDRAFT_67476  -  
Pfam View protein in Pfam  
PF03850  Tfb4  
Amino Acid Sequences MDAVDVSEHYEVTAADNSPSLLSIVLDTNPRAWAALDSSLSLAQAISNILVFVNAHLAFSNANQVAVIAAHVNRAVWLYPALQHPSSTTVKDNSGDVQMHDASAETSLPPPSANKYPQFAQIESSVFSSIQTLMAETTVQDLDQLTTQLSGALTLALCRINKAAQALSSSDTTLSNAAPVNATAPPPVKGRIVVVSVSDSDPSQYIPTMNAVFAAAHNQVAIDTISLAGDSTFLQQACFNTNGIFLKAANPRGLLTYLMFGLIPDTEARASLITPTHDTVDFRTACFCHGKVVDTGYVCSVCLSIFCTPPDNAECLTCGTVLALGNYGAKPAVLPRKKKKKKKIANGSGREETGSATGTPRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.15
5 0.14
6 0.14
7 0.11
8 0.08
9 0.08
10 0.09
11 0.1
12 0.11
13 0.14
14 0.14
15 0.16
16 0.16
17 0.16
18 0.15
19 0.14
20 0.14
21 0.14
22 0.17
23 0.16
24 0.16
25 0.17
26 0.17
27 0.16
28 0.14
29 0.11
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.1
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.18
48 0.13
49 0.13
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.08
64 0.09
65 0.09
66 0.12
67 0.16
68 0.21
69 0.2
70 0.2
71 0.2
72 0.25
73 0.26
74 0.25
75 0.24
76 0.22
77 0.24
78 0.25
79 0.25
80 0.21
81 0.23
82 0.21
83 0.18
84 0.19
85 0.17
86 0.16
87 0.15
88 0.13
89 0.09
90 0.09
91 0.09
92 0.06
93 0.07
94 0.08
95 0.08
96 0.08
97 0.09
98 0.13
99 0.19
100 0.24
101 0.25
102 0.28
103 0.3
104 0.37
105 0.39
106 0.35
107 0.31
108 0.29
109 0.27
110 0.24
111 0.23
112 0.16
113 0.13
114 0.12
115 0.11
116 0.09
117 0.09
118 0.08
119 0.07
120 0.06
121 0.07
122 0.06
123 0.05
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.05
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.07
144 0.07
145 0.07
146 0.08
147 0.08
148 0.09
149 0.11
150 0.11
151 0.09
152 0.11
153 0.11
154 0.12
155 0.12
156 0.11
157 0.1
158 0.1
159 0.09
160 0.09
161 0.08
162 0.07
163 0.07
164 0.07
165 0.06
166 0.06
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.1
173 0.11
174 0.13
175 0.12
176 0.12
177 0.13
178 0.13
179 0.14
180 0.12
181 0.11
182 0.11
183 0.11
184 0.11
185 0.1
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.08
195 0.09
196 0.08
197 0.08
198 0.08
199 0.07
200 0.07
201 0.09
202 0.08
203 0.07
204 0.07
205 0.07
206 0.06
207 0.07
208 0.07
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.03
216 0.04
217 0.04
218 0.06
219 0.07
220 0.08
221 0.08
222 0.1
223 0.11
224 0.13
225 0.14
226 0.12
227 0.11
228 0.13
229 0.14
230 0.13
231 0.13
232 0.1
233 0.16
234 0.2
235 0.22
236 0.2
237 0.2
238 0.2
239 0.21
240 0.21
241 0.16
242 0.12
243 0.11
244 0.1
245 0.1
246 0.09
247 0.07
248 0.07
249 0.06
250 0.06
251 0.05
252 0.06
253 0.06
254 0.06
255 0.07
256 0.07
257 0.07
258 0.08
259 0.1
260 0.11
261 0.13
262 0.14
263 0.16
264 0.17
265 0.17
266 0.18
267 0.24
268 0.23
269 0.21
270 0.23
271 0.22
272 0.23
273 0.26
274 0.24
275 0.22
276 0.22
277 0.24
278 0.22
279 0.25
280 0.26
281 0.23
282 0.24
283 0.2
284 0.19
285 0.17
286 0.15
287 0.12
288 0.08
289 0.08
290 0.1
291 0.11
292 0.13
293 0.15
294 0.18
295 0.18
296 0.23
297 0.24
298 0.24
299 0.22
300 0.2
301 0.2
302 0.19
303 0.2
304 0.16
305 0.13
306 0.11
307 0.12
308 0.12
309 0.11
310 0.09
311 0.09
312 0.11
313 0.11
314 0.12
315 0.09
316 0.09
317 0.09
318 0.15
319 0.26
320 0.32
321 0.42
322 0.53
323 0.64
324 0.76
325 0.86
326 0.9
327 0.91
328 0.94
329 0.95
330 0.96
331 0.95
332 0.96
333 0.94
334 0.91
335 0.85
336 0.75
337 0.64
338 0.53
339 0.43
340 0.34
341 0.26
342 0.18