Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RBD7

Protein Details
Accession G0RBD7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MRPLKYISKRKRKTKKKQETYNSRCSLVHydrophilic
NLS Segment(s)
PositionSequence
8-17SKRKRKTKKK
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
KEGG tre:TRIREDRAFT_56593  -  
Amino Acid Sequences MRPLKYISKRKRKTKKKQETYNSRCSLVVTHPTTNLPVSGLSMGEQTGPRVFHYLWSYVIVIAPRCTYQTIYANPRCTYQTIYANE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.95
3 0.94
4 0.95
5 0.95
6 0.96
7 0.93
8 0.92
9 0.83
10 0.73
11 0.62
12 0.52
13 0.43
14 0.36
15 0.36
16 0.29
17 0.27
18 0.26
19 0.26
20 0.27
21 0.25
22 0.21
23 0.13
24 0.09
25 0.08
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.08
35 0.08
36 0.08
37 0.11
38 0.11
39 0.13
40 0.16
41 0.16
42 0.16
43 0.17
44 0.17
45 0.14
46 0.16
47 0.14
48 0.12
49 0.12
50 0.12
51 0.11
52 0.12
53 0.14
54 0.14
55 0.17
56 0.23
57 0.28
58 0.37
59 0.43
60 0.48
61 0.47
62 0.48
63 0.46
64 0.42
65 0.4
66 0.37