Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RPN9

Protein Details
Accession G0RPN9   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKAMMMMKKKKKKKENRCISHSSFLHydrophilic
NLS Segment(s)
PositionSequence
8-14KKKKKKK
Subcellular Location(s) mito 17.5, mito_nucl 12.833, cyto_mito 10.666, nucl 6
Family & Domain DBs
KEGG tre:TRIREDRAFT_109608  -  
Amino Acid Sequences MKAMMMMKKKKKKKENRCISHSSFLGRLSNNPQACVLLPTWKVNSAVDKQWVFPSFPFEELPDPCQEITGGQSEALSYLETVAGDGDASVAGALTARHDSDSTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.9
5 0.89
6 0.84
7 0.8
8 0.7
9 0.61
10 0.52
11 0.44
12 0.4
13 0.31
14 0.28
15 0.27
16 0.33
17 0.3
18 0.29
19 0.27
20 0.24
21 0.24
22 0.23
23 0.17
24 0.15
25 0.16
26 0.17
27 0.18
28 0.19
29 0.19
30 0.18
31 0.21
32 0.18
33 0.19
34 0.22
35 0.22
36 0.21
37 0.23
38 0.24
39 0.21
40 0.18
41 0.21
42 0.16
43 0.17
44 0.17
45 0.15
46 0.17
47 0.17
48 0.19
49 0.15
50 0.16
51 0.14
52 0.14
53 0.13
54 0.1
55 0.1
56 0.11
57 0.1
58 0.09
59 0.09
60 0.08
61 0.09
62 0.09
63 0.07
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.06
82 0.08
83 0.08
84 0.1