Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0REC0

Protein Details
Accession G0REC0   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
166-195RGDGRRERKENMRRNERKMRKNERDAAAKMBasic
NLS Segment(s)
PositionSequence
87-119PREKPVPQPKPPTKWERFAAKKGIKPKTREQRK
157-199ADRKEGTSVRGDGRRERKENMRRNERKMRKNERDAAAKMGKKN
Subcellular Location(s) nucl 19, mito 5.5, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG tre:TRIREDRAFT_58428  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAVSISNKPKLPVVVEKPTPYTFDLGLLLAEDPNPVALDPSAIDASLAQLARDGAQSLINQLLTTCPLQSTSEGVLLSLPPPATRLPREKPVPQPKPPTKWERFAAKKGIKPKTREQRKNLAFDEESGEWKRKWGYKALNKKGEDDWLVEVDPKKEADRKEGTSVRGDGRRERKENMRRNERKMRKNERDAAAKMGKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.51
4 0.52
5 0.51
6 0.48
7 0.4
8 0.35
9 0.26
10 0.23
11 0.21
12 0.16
13 0.15
14 0.12
15 0.11
16 0.09
17 0.09
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.06
24 0.06
25 0.06
26 0.07
27 0.09
28 0.09
29 0.08
30 0.08
31 0.07
32 0.08
33 0.11
34 0.11
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.09
41 0.07
42 0.09
43 0.09
44 0.1
45 0.11
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.08
55 0.09
56 0.1
57 0.12
58 0.11
59 0.12
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.09
66 0.07
67 0.05
68 0.07
69 0.09
70 0.12
71 0.16
72 0.22
73 0.25
74 0.33
75 0.37
76 0.41
77 0.5
78 0.58
79 0.61
80 0.62
81 0.68
82 0.67
83 0.69
84 0.7
85 0.69
86 0.62
87 0.6
88 0.58
89 0.57
90 0.56
91 0.54
92 0.57
93 0.53
94 0.52
95 0.56
96 0.6
97 0.56
98 0.56
99 0.62
100 0.63
101 0.69
102 0.74
103 0.72
104 0.73
105 0.73
106 0.75
107 0.67
108 0.61
109 0.5
110 0.43
111 0.41
112 0.31
113 0.29
114 0.24
115 0.25
116 0.19
117 0.21
118 0.23
119 0.24
120 0.25
121 0.3
122 0.38
123 0.46
124 0.57
125 0.65
126 0.7
127 0.66
128 0.67
129 0.6
130 0.55
131 0.46
132 0.37
133 0.3
134 0.22
135 0.22
136 0.21
137 0.22
138 0.18
139 0.18
140 0.17
141 0.17
142 0.21
143 0.22
144 0.27
145 0.32
146 0.36
147 0.43
148 0.46
149 0.46
150 0.46
151 0.47
152 0.45
153 0.44
154 0.43
155 0.43
156 0.49
157 0.56
158 0.55
159 0.58
160 0.63
161 0.68
162 0.75
163 0.77
164 0.79
165 0.78
166 0.83
167 0.88
168 0.88
169 0.88
170 0.89
171 0.89
172 0.88
173 0.9
174 0.9
175 0.86
176 0.85
177 0.77
178 0.75
179 0.73