Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RE52

Protein Details
Accession G0RE52    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNTKSKKKWKRRRILCWFWPWSSHydrophilic
NLS Segment(s)
PositionSequence
5-13SKKKWKRRR
Subcellular Location(s) mito 20.5, mito_nucl 13.833, nucl 6
Family & Domain DBs
KEGG tre:TRIREDRAFT_105206  -  
Amino Acid Sequences MNTKSKKKWKRRRILCWFWPWSSDDLGLPTGRWLPAIGVNMAAPGISLDLRTTKSKGILLGMIDDYASSMKLYGRTHTKATTVKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.86
5 0.76
6 0.67
7 0.58
8 0.49
9 0.4
10 0.31
11 0.21
12 0.17
13 0.17
14 0.15
15 0.13
16 0.12
17 0.11
18 0.1
19 0.1
20 0.08
21 0.08
22 0.1
23 0.12
24 0.11
25 0.1
26 0.09
27 0.09
28 0.09
29 0.07
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.08
38 0.1
39 0.12
40 0.13
41 0.15
42 0.16
43 0.16
44 0.16
45 0.16
46 0.14
47 0.15
48 0.14
49 0.12
50 0.1
51 0.09
52 0.08
53 0.07
54 0.07
55 0.05
56 0.05
57 0.07
58 0.12
59 0.14
60 0.19
61 0.27
62 0.3
63 0.34
64 0.36
65 0.41