Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RJ90

Protein Details
Accession G0RJ90    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-60LCSSLRFRRLRTMRKRLNYPDRESLSHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 8, mito 7, pero 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046366  MPAB  
IPR018713  MPAB/Lcp_cat_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016491  F:oxidoreductase activity  
KEGG tre:TRIREDRAFT_107279  -  
Pfam View protein in Pfam  
PF09995  MPAB_Lcp_cat  
Amino Acid Sequences MGSLFSSSGDDLASRLGTSPWVLYSVAGFTFYAVLCSSLRFRRLRTMRKRLNYPDRESLSRMTNEDAQKIVYYLSIYEFPVLYDFSLRYAIFKTYAIDNIGNLLYRVSDLARPTEASKRYDDTQVLFASYVNFPPGSEALAKSVARTNFLHQPYRQCGKISNGDMLYVLFESMHEPVRWMRLYEWREMADMEVAAIATLWKYIGEMMDIDYRAELGKDQWKDGIEFMDDVAAWAAEYENRHLGPSPDIAKLGQVLVELMLSAYPSFSRAPGYKILMVLMGERMRHAFGFPEPGVVESVIAYSLLLTRKLFIRYLCLPRIVPATFISEPDPVTGRIKHYHFLKDPWYAPATFWARWGPEALFRRACGLKVAGDGGEAMLPDGFLFEDIGPRNEMGKGVEETARLAKAAQSKVSASACPFALPKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.11
5 0.12
6 0.13
7 0.11
8 0.13
9 0.13
10 0.12
11 0.13
12 0.13
13 0.12
14 0.12
15 0.11
16 0.1
17 0.12
18 0.11
19 0.12
20 0.1
21 0.11
22 0.1
23 0.13
24 0.18
25 0.21
26 0.29
27 0.31
28 0.34
29 0.43
30 0.53
31 0.62
32 0.67
33 0.73
34 0.76
35 0.82
36 0.89
37 0.89
38 0.9
39 0.88
40 0.84
41 0.83
42 0.78
43 0.73
44 0.66
45 0.59
46 0.55
47 0.48
48 0.42
49 0.36
50 0.37
51 0.36
52 0.35
53 0.32
54 0.27
55 0.24
56 0.23
57 0.2
58 0.13
59 0.11
60 0.1
61 0.11
62 0.12
63 0.12
64 0.13
65 0.12
66 0.11
67 0.12
68 0.12
69 0.1
70 0.1
71 0.1
72 0.1
73 0.13
74 0.13
75 0.13
76 0.15
77 0.16
78 0.15
79 0.16
80 0.16
81 0.15
82 0.18
83 0.19
84 0.17
85 0.16
86 0.17
87 0.17
88 0.15
89 0.13
90 0.1
91 0.08
92 0.07
93 0.08
94 0.07
95 0.1
96 0.11
97 0.13
98 0.14
99 0.15
100 0.18
101 0.25
102 0.27
103 0.27
104 0.29
105 0.31
106 0.32
107 0.35
108 0.34
109 0.29
110 0.29
111 0.27
112 0.24
113 0.21
114 0.18
115 0.16
116 0.15
117 0.13
118 0.11
119 0.1
120 0.09
121 0.11
122 0.11
123 0.1
124 0.11
125 0.11
126 0.11
127 0.16
128 0.16
129 0.15
130 0.2
131 0.18
132 0.2
133 0.21
134 0.23
135 0.27
136 0.31
137 0.35
138 0.32
139 0.39
140 0.43
141 0.45
142 0.43
143 0.36
144 0.35
145 0.35
146 0.4
147 0.35
148 0.33
149 0.29
150 0.27
151 0.27
152 0.24
153 0.19
154 0.11
155 0.09
156 0.04
157 0.05
158 0.05
159 0.06
160 0.09
161 0.08
162 0.09
163 0.1
164 0.15
165 0.15
166 0.15
167 0.15
168 0.22
169 0.25
170 0.27
171 0.28
172 0.25
173 0.25
174 0.24
175 0.22
176 0.14
177 0.11
178 0.08
179 0.06
180 0.05
181 0.04
182 0.04
183 0.03
184 0.02
185 0.03
186 0.03
187 0.02
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.06
194 0.08
195 0.08
196 0.08
197 0.07
198 0.08
199 0.07
200 0.07
201 0.06
202 0.06
203 0.12
204 0.13
205 0.13
206 0.15
207 0.16
208 0.16
209 0.17
210 0.15
211 0.1
212 0.09
213 0.09
214 0.07
215 0.07
216 0.06
217 0.05
218 0.04
219 0.03
220 0.03
221 0.03
222 0.04
223 0.05
224 0.07
225 0.08
226 0.09
227 0.09
228 0.1
229 0.11
230 0.11
231 0.14
232 0.16
233 0.15
234 0.15
235 0.15
236 0.15
237 0.14
238 0.12
239 0.09
240 0.06
241 0.05
242 0.05
243 0.05
244 0.04
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.05
252 0.06
253 0.06
254 0.09
255 0.1
256 0.13
257 0.17
258 0.2
259 0.2
260 0.2
261 0.19
262 0.17
263 0.16
264 0.14
265 0.13
266 0.12
267 0.1
268 0.11
269 0.11
270 0.11
271 0.11
272 0.11
273 0.09
274 0.09
275 0.15
276 0.15
277 0.16
278 0.15
279 0.16
280 0.17
281 0.15
282 0.14
283 0.07
284 0.08
285 0.06
286 0.05
287 0.05
288 0.04
289 0.07
290 0.08
291 0.1
292 0.1
293 0.11
294 0.14
295 0.17
296 0.19
297 0.16
298 0.22
299 0.28
300 0.35
301 0.36
302 0.36
303 0.34
304 0.34
305 0.38
306 0.32
307 0.26
308 0.2
309 0.24
310 0.22
311 0.23
312 0.23
313 0.19
314 0.19
315 0.19
316 0.2
317 0.15
318 0.19
319 0.2
320 0.22
321 0.27
322 0.29
323 0.33
324 0.36
325 0.43
326 0.43
327 0.45
328 0.46
329 0.46
330 0.46
331 0.44
332 0.43
333 0.34
334 0.31
335 0.36
336 0.35
337 0.28
338 0.29
339 0.28
340 0.27
341 0.27
342 0.29
343 0.22
344 0.26
345 0.31
346 0.35
347 0.33
348 0.32
349 0.37
350 0.36
351 0.35
352 0.31
353 0.27
354 0.23
355 0.22
356 0.23
357 0.18
358 0.16
359 0.16
360 0.12
361 0.11
362 0.09
363 0.07
364 0.06
365 0.06
366 0.05
367 0.05
368 0.05
369 0.05
370 0.06
371 0.06
372 0.12
373 0.14
374 0.16
375 0.17
376 0.18
377 0.19
378 0.18
379 0.19
380 0.16
381 0.18
382 0.18
383 0.2
384 0.22
385 0.21
386 0.23
387 0.25
388 0.24
389 0.2
390 0.18
391 0.2
392 0.25
393 0.29
394 0.29
395 0.29
396 0.29
397 0.35
398 0.37
399 0.35
400 0.3
401 0.29
402 0.26
403 0.26
404 0.27