Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0REG9

Protein Details
Accession G0REG9   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-79SQDDHHKKNTKTKKRHWWSRPTPSVKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.333, mito 8.5, cyto_mito 6.833, cyto 4
Family & Domain DBs
KEGG tre:TRIREDRAFT_105406  -  
Amino Acid Sequences MLVGDLVHFRAALSNGVSHDLILSPSTANTTPAVSRRNSTAACNTPDNRSIASQDDHHKKNTKTKKRHWWSRPTPSVKAANCGAGMKLPMNVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.17
4 0.16
5 0.14
6 0.13
7 0.11
8 0.11
9 0.09
10 0.09
11 0.06
12 0.07
13 0.09
14 0.09
15 0.1
16 0.1
17 0.11
18 0.12
19 0.16
20 0.19
21 0.18
22 0.18
23 0.2
24 0.23
25 0.23
26 0.23
27 0.26
28 0.27
29 0.29
30 0.32
31 0.31
32 0.29
33 0.3
34 0.29
35 0.23
36 0.2
37 0.18
38 0.16
39 0.17
40 0.18
41 0.24
42 0.3
43 0.31
44 0.35
45 0.41
46 0.41
47 0.5
48 0.58
49 0.6
50 0.63
51 0.72
52 0.78
53 0.82
54 0.91
55 0.9
56 0.9
57 0.9
58 0.91
59 0.91
60 0.87
61 0.8
62 0.76
63 0.75
64 0.65
65 0.59
66 0.5
67 0.42
68 0.36
69 0.33
70 0.27
71 0.2
72 0.21
73 0.17