Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RGU0

Protein Details
Accession G0RGU0   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MHPIPKPPRRRRYRNSHRRPINGRASASBasic
NLS Segment(s)
PositionSequence
5-20PKPPRRRRYRNSHRRP
Subcellular Location(s) mito_nucl 12.333, nucl 11.5, mito 11, cyto_nucl 8.166
Family & Domain DBs
KEGG tre:TRIREDRAFT_106584  -  
Amino Acid Sequences MHPIPKPPRRRRYRNSHRRPINGRASASIFRDLANWFFLMSASYAIRTLHYSPPIDTTADATLLVSGCLALRSTCQLFHIGIRSLVINRCQNIVISLMFRVLSGDVDRQDVESLHGYWFRGLNPPQTNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.92
5 0.92
6 0.89
7 0.87
8 0.85
9 0.8
10 0.71
11 0.63
12 0.58
13 0.52
14 0.47
15 0.4
16 0.3
17 0.24
18 0.24
19 0.21
20 0.18
21 0.16
22 0.13
23 0.1
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.07
30 0.07
31 0.08
32 0.08
33 0.09
34 0.1
35 0.13
36 0.15
37 0.18
38 0.18
39 0.18
40 0.21
41 0.21
42 0.19
43 0.17
44 0.15
45 0.12
46 0.11
47 0.11
48 0.08
49 0.07
50 0.06
51 0.06
52 0.04
53 0.03
54 0.03
55 0.03
56 0.04
57 0.03
58 0.04
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.12
66 0.15
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.15
73 0.19
74 0.19
75 0.19
76 0.2
77 0.2
78 0.19
79 0.18
80 0.18
81 0.13
82 0.11
83 0.11
84 0.1
85 0.1
86 0.09
87 0.09
88 0.08
89 0.08
90 0.09
91 0.12
92 0.12
93 0.14
94 0.14
95 0.15
96 0.15
97 0.14
98 0.15
99 0.15
100 0.15
101 0.16
102 0.17
103 0.17
104 0.18
105 0.19
106 0.18
107 0.23
108 0.25
109 0.32