Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RHU5

Protein Details
Accession G0RHU5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-134GMAALKPRDKSKKRAKAKKKKAASBasic
NLS Segment(s)
PositionSequence
116-134KPRDKSKKRAKAKKKKAAS
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG tre:TRIREDRAFT_61103  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MPNSANPHAQPIQFFDKLGHLFNHRKGSDHGAIYLIQKRLTYDPAEQQSTTAKLFPDLAPNKPLPVLVRATNGKSKRDDAARAGKEKLSVVVQPHELDAFYARYADVCKAGMAALKPRDKSKKRAKAKKKKAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.29
4 0.29
5 0.3
6 0.27
7 0.27
8 0.32
9 0.38
10 0.46
11 0.4
12 0.41
13 0.42
14 0.47
15 0.45
16 0.4
17 0.35
18 0.27
19 0.28
20 0.29
21 0.31
22 0.25
23 0.2
24 0.19
25 0.2
26 0.21
27 0.23
28 0.22
29 0.2
30 0.26
31 0.29
32 0.32
33 0.29
34 0.28
35 0.28
36 0.26
37 0.24
38 0.18
39 0.13
40 0.12
41 0.14
42 0.14
43 0.2
44 0.21
45 0.22
46 0.24
47 0.24
48 0.23
49 0.22
50 0.22
51 0.13
52 0.14
53 0.14
54 0.12
55 0.16
56 0.17
57 0.19
58 0.25
59 0.26
60 0.27
61 0.27
62 0.28
63 0.28
64 0.3
65 0.31
66 0.3
67 0.37
68 0.38
69 0.39
70 0.38
71 0.35
72 0.33
73 0.3
74 0.26
75 0.18
76 0.16
77 0.16
78 0.17
79 0.18
80 0.17
81 0.17
82 0.16
83 0.14
84 0.12
85 0.12
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.1
92 0.11
93 0.11
94 0.1
95 0.1
96 0.1
97 0.1
98 0.12
99 0.13
100 0.19
101 0.25
102 0.3
103 0.33
104 0.41
105 0.52
106 0.55
107 0.64
108 0.68
109 0.71
110 0.77
111 0.85
112 0.89
113 0.89
114 0.95