Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RH61

Protein Details
Accession G0RH61   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-98IEQPIAQKQRRRDYLRNLMGKRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 10, nucl 7, mito 2, plas 2, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG tre:TRIREDRAFT_106450  -  
Amino Acid Sequences MDALTHLLTVRCTETQESNTCEKPASQSGILIAVVITTGIFLLGSLLLVLFWLWLRRRKIDKLEEASDPFELAAYGIEQPIAQKQRRRDYLRNLMGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.3
4 0.33
5 0.35
6 0.36
7 0.34
8 0.32
9 0.28
10 0.28
11 0.27
12 0.27
13 0.22
14 0.2
15 0.2
16 0.21
17 0.2
18 0.15
19 0.1
20 0.06
21 0.05
22 0.05
23 0.04
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.05
40 0.08
41 0.15
42 0.17
43 0.23
44 0.29
45 0.34
46 0.43
47 0.48
48 0.54
49 0.54
50 0.55
51 0.52
52 0.49
53 0.45
54 0.37
55 0.29
56 0.2
57 0.14
58 0.1
59 0.07
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.14
68 0.21
69 0.25
70 0.31
71 0.4
72 0.51
73 0.61
74 0.69
75 0.7
76 0.74
77 0.8
78 0.84