Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RNP8

Protein Details
Accession G0RNP8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-85HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tre:TRIREDRAFT_122697  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLLRTLSLTAGLLRSAPATASVVKGSLATASPISAWMGWMARPAVGGALQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.07
7 0.09
8 0.09
9 0.1
10 0.1
11 0.1
12 0.1
13 0.1
14 0.09
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.06
31 0.07
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.09
41 0.09
42 0.1
43 0.11
44 0.1
45 0.11
46 0.2
47 0.26
48 0.34
49 0.39
50 0.46
51 0.53
52 0.57
53 0.63
54 0.62
55 0.65
56 0.67
57 0.72
58 0.75
59 0.78
60 0.81
61 0.81
62 0.81
63 0.82
64 0.83
65 0.83
66 0.8
67 0.79
68 0.77
69 0.72
70 0.68
71 0.64
72 0.57
73 0.5
74 0.43
75 0.35
76 0.35
77 0.39
78 0.45
79 0.48
80 0.54