Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RIB8

Protein Details
Accession G0RIB8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
157-197AETSAEKKKKHQDIEKRFHEARVQDKKYNSAKKQSRRGPQEHydrophilic
NLS Segment(s)
PositionSequence
164-167KKKH
183-183K
186-192SAKKQSR
Subcellular Location(s) mito 20, nucl 5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG tre:TRIREDRAFT_60768  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MFLLSRLPKRTALSAVAPRQPRLSLVSSQPVRFKRYEAYDAQLDQDALAEARLWYNSFDASQLPKGNTTYARSSGPGGQHVNKTETKAITVIPVKELLAVLPKYLHSAVRSSKYYTAGNDSLTFSAQAHRSRSANLDENRRKLIDEVMGIYRQLTPAETSAEKKKKHQDIEKRFHEARVQDKKYNSAKKQSRRGPQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.51
4 0.51
5 0.49
6 0.47
7 0.43
8 0.37
9 0.33
10 0.31
11 0.28
12 0.3
13 0.38
14 0.4
15 0.42
16 0.47
17 0.46
18 0.47
19 0.43
20 0.41
21 0.38
22 0.41
23 0.44
24 0.39
25 0.41
26 0.39
27 0.39
28 0.38
29 0.32
30 0.25
31 0.19
32 0.17
33 0.12
34 0.08
35 0.08
36 0.06
37 0.05
38 0.06
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.1
47 0.12
48 0.16
49 0.18
50 0.18
51 0.19
52 0.19
53 0.21
54 0.22
55 0.23
56 0.22
57 0.22
58 0.22
59 0.21
60 0.22
61 0.23
62 0.22
63 0.22
64 0.22
65 0.23
66 0.25
67 0.26
68 0.28
69 0.26
70 0.26
71 0.25
72 0.22
73 0.2
74 0.17
75 0.16
76 0.16
77 0.18
78 0.16
79 0.13
80 0.14
81 0.13
82 0.12
83 0.12
84 0.08
85 0.09
86 0.09
87 0.08
88 0.08
89 0.09
90 0.1
91 0.11
92 0.12
93 0.08
94 0.12
95 0.15
96 0.19
97 0.21
98 0.21
99 0.24
100 0.25
101 0.26
102 0.24
103 0.26
104 0.22
105 0.22
106 0.21
107 0.2
108 0.17
109 0.16
110 0.15
111 0.1
112 0.12
113 0.15
114 0.18
115 0.19
116 0.22
117 0.22
118 0.23
119 0.26
120 0.28
121 0.32
122 0.33
123 0.41
124 0.45
125 0.48
126 0.5
127 0.47
128 0.43
129 0.35
130 0.34
131 0.26
132 0.21
133 0.2
134 0.2
135 0.2
136 0.19
137 0.19
138 0.16
139 0.13
140 0.12
141 0.1
142 0.09
143 0.1
144 0.14
145 0.15
146 0.19
147 0.29
148 0.36
149 0.38
150 0.44
151 0.53
152 0.58
153 0.66
154 0.72
155 0.73
156 0.77
157 0.85
158 0.84
159 0.83
160 0.75
161 0.68
162 0.64
163 0.58
164 0.58
165 0.59
166 0.58
167 0.56
168 0.57
169 0.63
170 0.67
171 0.72
172 0.69
173 0.69
174 0.72
175 0.76
176 0.84
177 0.84