Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0R884

Protein Details
Accession G0R884    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-133VVRARAPRTPKKELKKEPKEEPVSBasic
NLS Segment(s)
PositionSequence
77-98KRKPAAGDAGSAKKKTKATKKE
107-128VKPVVRARAPRTPKKELKKEPK
Subcellular Location(s) cyto_mito 11.166, mito 10.5, cyto 9.5, mito_nucl 9.499, cyto_nucl 8.999, nucl 7
Family & Domain DBs
KEGG tre:TRIREDRAFT_102773  -  
Amino Acid Sequences MSKQDPAEQVRFLVSCIGHTTNGRPDFTLVAQELGIVSKAAAQKRYERMLKANGVSASSKKASGDDDLTTPASTPVKRKPAAGDAGSAKKKTKATKKEESDDDMKDVKPVVRARAPRTPKKELKKEPKEEPVSPASARSELLGFGNTYGLVGEVMSAVLKHHEAGYLPNYLVQYGFFSNWYMRFSTVYRSGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.2
4 0.21
5 0.2
6 0.21
7 0.25
8 0.29
9 0.33
10 0.33
11 0.29
12 0.28
13 0.29
14 0.28
15 0.28
16 0.2
17 0.17
18 0.16
19 0.15
20 0.14
21 0.11
22 0.11
23 0.06
24 0.06
25 0.09
26 0.13
27 0.16
28 0.19
29 0.21
30 0.28
31 0.34
32 0.41
33 0.42
34 0.41
35 0.43
36 0.46
37 0.49
38 0.43
39 0.42
40 0.35
41 0.32
42 0.31
43 0.27
44 0.24
45 0.2
46 0.2
47 0.15
48 0.16
49 0.16
50 0.16
51 0.18
52 0.15
53 0.15
54 0.16
55 0.17
56 0.16
57 0.14
58 0.13
59 0.13
60 0.13
61 0.17
62 0.22
63 0.29
64 0.3
65 0.31
66 0.32
67 0.35
68 0.39
69 0.35
70 0.31
71 0.27
72 0.33
73 0.34
74 0.32
75 0.27
76 0.27
77 0.3
78 0.35
79 0.41
80 0.44
81 0.5
82 0.59
83 0.63
84 0.65
85 0.64
86 0.61
87 0.55
88 0.46
89 0.41
90 0.32
91 0.27
92 0.21
93 0.2
94 0.16
95 0.18
96 0.19
97 0.2
98 0.24
99 0.28
100 0.32
101 0.41
102 0.48
103 0.51
104 0.56
105 0.62
106 0.65
107 0.7
108 0.76
109 0.77
110 0.81
111 0.83
112 0.83
113 0.81
114 0.82
115 0.78
116 0.69
117 0.64
118 0.56
119 0.49
120 0.41
121 0.36
122 0.28
123 0.23
124 0.21
125 0.17
126 0.14
127 0.11
128 0.12
129 0.11
130 0.09
131 0.08
132 0.08
133 0.07
134 0.07
135 0.06
136 0.06
137 0.04
138 0.04
139 0.04
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.06
146 0.06
147 0.07
148 0.07
149 0.08
150 0.09
151 0.13
152 0.15
153 0.16
154 0.16
155 0.18
156 0.18
157 0.17
158 0.16
159 0.13
160 0.14
161 0.13
162 0.14
163 0.12
164 0.14
165 0.17
166 0.19
167 0.21
168 0.19
169 0.18
170 0.21
171 0.21
172 0.27