Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RL68

Protein Details
Accession G0RL68   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
137-156LFVRGGRRTKWPSSRRGVRDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008253  Marvel  
Gene Ontology GO:0016020  C:membrane  
KEGG tre:TRIREDRAFT_108261  -  
Pfam View protein in Pfam  
PF01284  MARVEL  
Amino Acid Sequences MSRMLILCFRAIQGLMAAASIALAAYVINWHLRGSHLSTPPSIGFLLFCPIFALSSLLYLELAPRFAPKATHPTASLCIEIANCIFYFAGFIAVAVCLGDLAFCDGSVCMAGRGAAVLAAAQFGLWMGSAIFAARNLFVRGGRRTKWPSSRRGVRDLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.08
5 0.06
6 0.05
7 0.04
8 0.04
9 0.02
10 0.02
11 0.02
12 0.02
13 0.03
14 0.04
15 0.05
16 0.06
17 0.06
18 0.07
19 0.09
20 0.11
21 0.16
22 0.22
23 0.26
24 0.27
25 0.27
26 0.29
27 0.28
28 0.27
29 0.22
30 0.15
31 0.11
32 0.1
33 0.13
34 0.11
35 0.11
36 0.1
37 0.09
38 0.1
39 0.09
40 0.1
41 0.06
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.09
55 0.09
56 0.17
57 0.19
58 0.2
59 0.2
60 0.22
61 0.24
62 0.24
63 0.22
64 0.15
65 0.13
66 0.11
67 0.11
68 0.09
69 0.06
70 0.05
71 0.05
72 0.05
73 0.04
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.02
85 0.02
86 0.02
87 0.02
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.04
97 0.04
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.05
119 0.05
120 0.06
121 0.07
122 0.09
123 0.1
124 0.12
125 0.15
126 0.2
127 0.27
128 0.34
129 0.35
130 0.43
131 0.49
132 0.57
133 0.64
134 0.66
135 0.68
136 0.72
137 0.8
138 0.77
139 0.78