Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0R885

Protein Details
Accession G0R885   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-117DGKVAKKPRVRTPRKPVAKKDLSEBasic
NLS Segment(s)
PositionSequence
92-113SGDGKVAKKPRVRTPRKPVAKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
KEGG tre:TRIREDRAFT_102774  -  
Amino Acid Sequences MPPKKSDNADGPAVSGLRDNELRFIKAVFDNMTQKPDANWTQVASDLGLKDAKCAKERFRQMSVRHGWRTTGQTTPGSSPSKAKKGDVTGPSGDGKVAKKPRVRTPRKPVAKKDLSEDDEGDDVHKDEDDVKEEKMGSEEDDEIYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.16
4 0.15
5 0.18
6 0.17
7 0.21
8 0.24
9 0.25
10 0.23
11 0.23
12 0.22
13 0.21
14 0.23
15 0.19
16 0.21
17 0.26
18 0.26
19 0.29
20 0.26
21 0.25
22 0.23
23 0.27
24 0.25
25 0.23
26 0.22
27 0.2
28 0.2
29 0.21
30 0.21
31 0.15
32 0.14
33 0.11
34 0.11
35 0.12
36 0.11
37 0.13
38 0.17
39 0.19
40 0.22
41 0.25
42 0.29
43 0.36
44 0.44
45 0.46
46 0.48
47 0.53
48 0.51
49 0.57
50 0.59
51 0.57
52 0.52
53 0.47
54 0.42
55 0.37
56 0.39
57 0.32
58 0.26
59 0.21
60 0.2
61 0.21
62 0.21
63 0.23
64 0.21
65 0.2
66 0.24
67 0.26
68 0.31
69 0.31
70 0.31
71 0.3
72 0.32
73 0.39
74 0.36
75 0.35
76 0.29
77 0.3
78 0.3
79 0.26
80 0.22
81 0.17
82 0.16
83 0.2
84 0.26
85 0.3
86 0.35
87 0.41
88 0.51
89 0.59
90 0.68
91 0.7
92 0.74
93 0.79
94 0.84
95 0.87
96 0.85
97 0.85
98 0.84
99 0.75
100 0.71
101 0.69
102 0.62
103 0.56
104 0.49
105 0.4
106 0.32
107 0.31
108 0.25
109 0.16
110 0.13
111 0.11
112 0.1
113 0.08
114 0.1
115 0.13
116 0.16
117 0.17
118 0.17
119 0.2
120 0.2
121 0.2
122 0.2
123 0.18
124 0.16
125 0.17
126 0.18