Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RP70

Protein Details
Accession G0RP70   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-117RLVKEYQEKQRKKKEKEKEKDKEKDKEKDKDKNKEKDKDEBasic
NLS Segment(s)
PositionSequence
76-124KERLVKEYQEKQRKKKEKEKEKDKEKDKEKDKDKNKEKDKDEDKDKSKE
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG tre:TRIREDRAFT_65004  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MAAPFPNLYTLRKVAESAAKGCDVCYKPSSSVLITPDKKDFFYICPAHLKDRYFCTPKIDEDAVKAKREKELAEEKERLVKEYQEKQRKKKEKEKEKDKEKDKEKDKDKNKEKDKDEDKDKSKEKEENQKNSGGETPKQEDEPRVFELKIAFYQQRLQRKRQAEAAKRDRERASQPNYFPSVPTEPPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.33
4 0.3
5 0.3
6 0.29
7 0.28
8 0.28
9 0.33
10 0.27
11 0.28
12 0.28
13 0.29
14 0.28
15 0.31
16 0.33
17 0.26
18 0.28
19 0.28
20 0.35
21 0.34
22 0.36
23 0.38
24 0.37
25 0.36
26 0.35
27 0.32
28 0.25
29 0.31
30 0.3
31 0.27
32 0.33
33 0.34
34 0.37
35 0.4
36 0.4
37 0.34
38 0.39
39 0.44
40 0.41
41 0.4
42 0.4
43 0.39
44 0.38
45 0.41
46 0.36
47 0.29
48 0.29
49 0.37
50 0.33
51 0.34
52 0.35
53 0.3
54 0.31
55 0.32
56 0.28
57 0.26
58 0.33
59 0.35
60 0.4
61 0.4
62 0.38
63 0.43
64 0.42
65 0.37
66 0.28
67 0.26
68 0.27
69 0.35
70 0.44
71 0.48
72 0.54
73 0.61
74 0.71
75 0.77
76 0.79
77 0.79
78 0.8
79 0.81
80 0.85
81 0.88
82 0.87
83 0.87
84 0.88
85 0.86
86 0.84
87 0.81
88 0.79
89 0.76
90 0.75
91 0.73
92 0.74
93 0.75
94 0.77
95 0.78
96 0.79
97 0.8
98 0.8
99 0.75
100 0.76
101 0.74
102 0.71
103 0.69
104 0.68
105 0.64
106 0.64
107 0.66
108 0.6
109 0.58
110 0.57
111 0.56
112 0.58
113 0.62
114 0.63
115 0.6
116 0.6
117 0.56
118 0.51
119 0.49
120 0.42
121 0.35
122 0.32
123 0.33
124 0.3
125 0.32
126 0.32
127 0.31
128 0.31
129 0.32
130 0.31
131 0.29
132 0.27
133 0.26
134 0.26
135 0.24
136 0.23
137 0.23
138 0.21
139 0.19
140 0.27
141 0.32
142 0.41
143 0.44
144 0.49
145 0.53
146 0.58
147 0.61
148 0.63
149 0.67
150 0.66
151 0.72
152 0.75
153 0.77
154 0.74
155 0.76
156 0.71
157 0.66
158 0.65
159 0.63
160 0.61
161 0.59
162 0.58
163 0.59
164 0.61
165 0.56
166 0.48
167 0.45
168 0.43
169 0.4