Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0R9T8

Protein Details
Accession G0R9T8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-54YFDYKRRRDAEFRRNLRRNERKQVRAEKEEBasic
NLS Segment(s)
PositionSequence
36-46FRRNLRRNERK
Subcellular Location(s) cyto 12.5, cyto_nucl 10, mito 7, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
KEGG tre:TRIREDRAFT_120173  -  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MVNTSTVVTASVATIATGLVAYAAYFDYKRRRDAEFRRNLRRNERKQVRAEKEEAEASTQRLRSLIKAKVDEAKEEGFPAGVEEREAFFNEQVMTGEMLSQDPSKMIDSALAFYKGLKVYPAPGDLIKIYDSTVPKPILDILADMIAYDGDIMVRTRPSSSGPINLGEIPNVGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.06
12 0.06
13 0.11
14 0.21
15 0.24
16 0.3
17 0.32
18 0.38
19 0.47
20 0.57
21 0.64
22 0.65
23 0.71
24 0.77
25 0.81
26 0.82
27 0.83
28 0.84
29 0.82
30 0.82
31 0.83
32 0.8
33 0.82
34 0.86
35 0.83
36 0.78
37 0.72
38 0.62
39 0.55
40 0.49
41 0.4
42 0.33
43 0.26
44 0.22
45 0.23
46 0.21
47 0.19
48 0.18
49 0.18
50 0.19
51 0.24
52 0.27
53 0.27
54 0.28
55 0.3
56 0.35
57 0.35
58 0.32
59 0.28
60 0.24
61 0.19
62 0.18
63 0.17
64 0.1
65 0.09
66 0.09
67 0.07
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.08
74 0.08
75 0.07
76 0.08
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.05
89 0.05
90 0.06
91 0.07
92 0.07
93 0.07
94 0.08
95 0.09
96 0.1
97 0.12
98 0.12
99 0.11
100 0.11
101 0.14
102 0.12
103 0.11
104 0.11
105 0.1
106 0.12
107 0.14
108 0.15
109 0.14
110 0.14
111 0.15
112 0.14
113 0.15
114 0.13
115 0.11
116 0.1
117 0.13
118 0.15
119 0.15
120 0.2
121 0.2
122 0.19
123 0.2
124 0.2
125 0.17
126 0.15
127 0.14
128 0.1
129 0.1
130 0.1
131 0.09
132 0.08
133 0.06
134 0.05
135 0.05
136 0.03
137 0.03
138 0.04
139 0.05
140 0.07
141 0.08
142 0.09
143 0.11
144 0.12
145 0.16
146 0.21
147 0.24
148 0.29
149 0.3
150 0.31
151 0.32
152 0.34
153 0.31
154 0.25
155 0.22