Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PFC1

Protein Details
Accession A0A1D8PFC1   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-59EFIPPPTAKDKQNKNNNKKKDVAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, mito 9, cyto_nucl 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018165  Ala-tRNA-synth_IIc_core  
IPR018164  Ala-tRNA-synth_IIc_N  
IPR018163  Thr/Ala-tRNA-synth_IIc_edit  
IPR009000  Transl_B-barrel_sf  
IPR012947  tRNA_SAD  
Gene Ontology GO:0004813  F:alanine-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0003676  F:nucleic acid binding  
GO:0002196  F:Ser-tRNA(Ala) hydrolase activity  
GO:0006419  P:alanyl-tRNA aminoacylation  
GO:0006450  P:regulation of translational fidelity  
KEGG cal:CAALFM_C112240CA  -  
Pfam View protein in Pfam  
PF01411  tRNA-synt_2c  
PF07973  tRNA_SAD  
PROSITE View protein in PROSITE  
PS50860  AA_TRNA_LIGASE_II_ALA  
Amino Acid Sequences MATTATGTTTAIVGALACQKNSFLKTFNTKVVSSYEFIPPPTAKDKQNKNNNKKKDVAVSKEFGVELEDTILFPEGGGQPYDKGTITLLPDNTKIIEVKSVLRDKLKAIHLVDELIEPGTQVRLNVDWGRRLDIMQQHTGQHLLSAVFDTYKLETLSWSMGETKDDINYIELPRKIDNDLVVEVQNKVNQLIVDSIPITVVTSDQHGHGHGQEHEHEHEHEHADVDISHIPDDYDLSQGGIIRIVKIGELDANPCCGTHLTSTAQIQSIALLHQSPIRGGHSRLYFICGGRVANHLRKEHEILKNVSTNQLSCSIDAVEEKIELLSLNYKKTNSTLNNLLKELASIEANKIFQNFKTHDNNNSKLAYVYRADLPEYLTWVQKELTTLINQDKTGDVDLSNKQTLVLLSGAAPNGGTIKILGPKAEELQKELKSKLSNLKGGGKGSSFQGKITKFEKGELEAVLKYLDSML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.16
3 0.17
4 0.17
5 0.17
6 0.19
7 0.25
8 0.28
9 0.29
10 0.23
11 0.3
12 0.38
13 0.43
14 0.48
15 0.47
16 0.44
17 0.43
18 0.45
19 0.41
20 0.34
21 0.32
22 0.32
23 0.29
24 0.29
25 0.32
26 0.28
27 0.3
28 0.35
29 0.37
30 0.38
31 0.47
32 0.57
33 0.62
34 0.72
35 0.79
36 0.83
37 0.88
38 0.9
39 0.88
40 0.83
41 0.79
42 0.79
43 0.77
44 0.74
45 0.71
46 0.64
47 0.58
48 0.53
49 0.47
50 0.37
51 0.29
52 0.21
53 0.14
54 0.13
55 0.12
56 0.1
57 0.11
58 0.11
59 0.09
60 0.08
61 0.11
62 0.11
63 0.12
64 0.13
65 0.13
66 0.13
67 0.15
68 0.17
69 0.13
70 0.12
71 0.11
72 0.14
73 0.17
74 0.2
75 0.21
76 0.22
77 0.23
78 0.23
79 0.23
80 0.21
81 0.19
82 0.14
83 0.16
84 0.15
85 0.19
86 0.25
87 0.3
88 0.31
89 0.33
90 0.34
91 0.33
92 0.38
93 0.38
94 0.36
95 0.32
96 0.33
97 0.31
98 0.3
99 0.29
100 0.22
101 0.18
102 0.13
103 0.12
104 0.07
105 0.07
106 0.08
107 0.07
108 0.07
109 0.08
110 0.08
111 0.12
112 0.18
113 0.2
114 0.23
115 0.24
116 0.28
117 0.27
118 0.27
119 0.28
120 0.29
121 0.32
122 0.31
123 0.32
124 0.29
125 0.29
126 0.3
127 0.24
128 0.18
129 0.14
130 0.1
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.09
140 0.08
141 0.09
142 0.1
143 0.11
144 0.1
145 0.1
146 0.1
147 0.1
148 0.1
149 0.11
150 0.11
151 0.1
152 0.11
153 0.1
154 0.1
155 0.13
156 0.13
157 0.17
158 0.18
159 0.19
160 0.2
161 0.21
162 0.2
163 0.19
164 0.19
165 0.16
166 0.16
167 0.15
168 0.15
169 0.14
170 0.14
171 0.14
172 0.14
173 0.12
174 0.11
175 0.11
176 0.1
177 0.09
178 0.1
179 0.09
180 0.09
181 0.09
182 0.09
183 0.07
184 0.07
185 0.07
186 0.05
187 0.05
188 0.04
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.09
195 0.1
196 0.12
197 0.12
198 0.13
199 0.14
200 0.16
201 0.17
202 0.18
203 0.17
204 0.16
205 0.16
206 0.16
207 0.14
208 0.12
209 0.1
210 0.09
211 0.09
212 0.09
213 0.09
214 0.08
215 0.08
216 0.08
217 0.08
218 0.07
219 0.08
220 0.07
221 0.06
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.07
228 0.07
229 0.06
230 0.07
231 0.07
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.08
238 0.07
239 0.09
240 0.09
241 0.09
242 0.09
243 0.08
244 0.09
245 0.08
246 0.11
247 0.11
248 0.13
249 0.14
250 0.14
251 0.14
252 0.13
253 0.12
254 0.1
255 0.08
256 0.07
257 0.06
258 0.05
259 0.05
260 0.07
261 0.07
262 0.07
263 0.08
264 0.11
265 0.13
266 0.14
267 0.19
268 0.19
269 0.21
270 0.21
271 0.23
272 0.22
273 0.2
274 0.2
275 0.16
276 0.15
277 0.14
278 0.18
279 0.2
280 0.24
281 0.29
282 0.29
283 0.31
284 0.33
285 0.36
286 0.4
287 0.4
288 0.4
289 0.37
290 0.39
291 0.41
292 0.38
293 0.38
294 0.31
295 0.26
296 0.22
297 0.25
298 0.22
299 0.18
300 0.18
301 0.14
302 0.14
303 0.14
304 0.13
305 0.08
306 0.08
307 0.08
308 0.06
309 0.06
310 0.06
311 0.06
312 0.12
313 0.14
314 0.17
315 0.19
316 0.2
317 0.2
318 0.22
319 0.3
320 0.26
321 0.3
322 0.36
323 0.41
324 0.43
325 0.43
326 0.42
327 0.34
328 0.31
329 0.26
330 0.17
331 0.12
332 0.1
333 0.11
334 0.13
335 0.14
336 0.14
337 0.15
338 0.15
339 0.16
340 0.23
341 0.23
342 0.28
343 0.36
344 0.38
345 0.46
346 0.52
347 0.54
348 0.51
349 0.5
350 0.43
351 0.36
352 0.34
353 0.28
354 0.22
355 0.21
356 0.2
357 0.2
358 0.21
359 0.2
360 0.21
361 0.18
362 0.21
363 0.2
364 0.19
365 0.18
366 0.19
367 0.19
368 0.17
369 0.18
370 0.15
371 0.17
372 0.16
373 0.19
374 0.24
375 0.26
376 0.25
377 0.25
378 0.24
379 0.23
380 0.23
381 0.2
382 0.15
383 0.16
384 0.21
385 0.25
386 0.25
387 0.23
388 0.21
389 0.22
390 0.21
391 0.19
392 0.15
393 0.1
394 0.1
395 0.12
396 0.12
397 0.11
398 0.1
399 0.08
400 0.09
401 0.09
402 0.08
403 0.06
404 0.09
405 0.14
406 0.16
407 0.16
408 0.17
409 0.19
410 0.24
411 0.3
412 0.28
413 0.28
414 0.35
415 0.4
416 0.43
417 0.42
418 0.43
419 0.39
420 0.45
421 0.5
422 0.5
423 0.49
424 0.5
425 0.57
426 0.56
427 0.54
428 0.51
429 0.43
430 0.36
431 0.35
432 0.39
433 0.31
434 0.29
435 0.35
436 0.33
437 0.38
438 0.39
439 0.43
440 0.36
441 0.4
442 0.41
443 0.38
444 0.39
445 0.35
446 0.35
447 0.27
448 0.27
449 0.23
450 0.19