Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RFC8

Protein Details
Accession G0RFC8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
134-160DDAEQTSNRKPKKKAKKIKLSFDEDEGHydrophilic
NLS Segment(s)
PositionSequence
93-104ARASIGGRKRKV
142-152RKPKKKAKKIK
Subcellular Location(s) nucl 12, mito 9.5, cyto_mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG tre:TRIREDRAFT_120915  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKVNAKNLSYNSSLPPFLAALRAQAAGATGPDPILAAQRRGAKKRSGSEEAEDAPLVVDEHGNALEDLKAEEESKDDGKLDAAKKSEAEPARASIGGRKRKVGKVVGEEAHDGAAESAATGKKSETSRKETDDAEQTSNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.27
4 0.25
5 0.21
6 0.18
7 0.19
8 0.14
9 0.13
10 0.14
11 0.14
12 0.12
13 0.12
14 0.12
15 0.09
16 0.09
17 0.07
18 0.06
19 0.05
20 0.05
21 0.06
22 0.05
23 0.11
24 0.12
25 0.13
26 0.17
27 0.25
28 0.31
29 0.36
30 0.4
31 0.41
32 0.46
33 0.52
34 0.56
35 0.54
36 0.5
37 0.48
38 0.48
39 0.43
40 0.37
41 0.29
42 0.22
43 0.16
44 0.13
45 0.1
46 0.07
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.13
69 0.13
70 0.14
71 0.15
72 0.15
73 0.15
74 0.16
75 0.22
76 0.19
77 0.21
78 0.19
79 0.19
80 0.2
81 0.2
82 0.19
83 0.18
84 0.25
85 0.31
86 0.31
87 0.35
88 0.39
89 0.42
90 0.48
91 0.48
92 0.45
93 0.43
94 0.48
95 0.45
96 0.41
97 0.38
98 0.32
99 0.27
100 0.21
101 0.15
102 0.08
103 0.07
104 0.05
105 0.04
106 0.06
107 0.07
108 0.08
109 0.08
110 0.08
111 0.13
112 0.18
113 0.27
114 0.31
115 0.38
116 0.43
117 0.48
118 0.51
119 0.48
120 0.49
121 0.48
122 0.45
123 0.42
124 0.41
125 0.39
126 0.45
127 0.51
128 0.53
129 0.53
130 0.58
131 0.64
132 0.71
133 0.8
134 0.82
135 0.86
136 0.9
137 0.92
138 0.94
139 0.93
140 0.9