Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RM44

Protein Details
Accession G0RM44   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-113QQQQQPQHSQSKKKNPRTESRAAHydrophilic
247-275FVLAKGACVKRGRRRRREAKSHASPPCPSHydrophilic
NLS Segment(s)
PositionSequence
256-267KRGRRRRREAKS
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
KEGG tre:TRIREDRAFT_108605  -  
Amino Acid Sequences MNSFSPKSIRPDFLKSKNRGSAIPSLTSAAEKATGPEAFRDHDVTAAFGDACKEQNMHRSYPVLRYGTQRGTVLNRPIASPGSGVSSAAQQQQQQPQHSQSKKKNPRTESRAAGGTKYISSLFSCCSLLFPETRRRPTTHPPWPPLWVQIDQLILPAGWIAEAVSVLPRGKTPKFLDCIPRRETWRGEHEDAQGQTPAHAPPLLSARFHRLLVPSRGDAKRDLVPDSSAQKAIKFPSPSERSSYEYFVLAKGACVKRGRRRRREAKSHASPPCPSRRLDALQRNFAMYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.72
4 0.73
5 0.7
6 0.62
7 0.58
8 0.56
9 0.5
10 0.47
11 0.39
12 0.33
13 0.32
14 0.3
15 0.25
16 0.17
17 0.14
18 0.12
19 0.12
20 0.14
21 0.15
22 0.15
23 0.18
24 0.19
25 0.2
26 0.22
27 0.23
28 0.19
29 0.2
30 0.2
31 0.18
32 0.16
33 0.15
34 0.12
35 0.1
36 0.11
37 0.1
38 0.11
39 0.11
40 0.12
41 0.12
42 0.21
43 0.25
44 0.26
45 0.27
46 0.3
47 0.31
48 0.36
49 0.41
50 0.34
51 0.33
52 0.36
53 0.4
54 0.39
55 0.39
56 0.34
57 0.3
58 0.33
59 0.36
60 0.36
61 0.34
62 0.31
63 0.29
64 0.3
65 0.28
66 0.23
67 0.18
68 0.14
69 0.13
70 0.12
71 0.12
72 0.11
73 0.12
74 0.13
75 0.16
76 0.17
77 0.16
78 0.2
79 0.28
80 0.33
81 0.34
82 0.36
83 0.4
84 0.48
85 0.51
86 0.56
87 0.58
88 0.64
89 0.72
90 0.78
91 0.8
92 0.78
93 0.82
94 0.81
95 0.79
96 0.72
97 0.64
98 0.6
99 0.52
100 0.45
101 0.36
102 0.28
103 0.21
104 0.17
105 0.14
106 0.09
107 0.09
108 0.09
109 0.09
110 0.1
111 0.1
112 0.09
113 0.09
114 0.1
115 0.11
116 0.11
117 0.14
118 0.23
119 0.28
120 0.34
121 0.36
122 0.38
123 0.42
124 0.5
125 0.56
126 0.56
127 0.57
128 0.56
129 0.55
130 0.55
131 0.5
132 0.44
133 0.38
134 0.29
135 0.22
136 0.2
137 0.18
138 0.15
139 0.15
140 0.11
141 0.08
142 0.06
143 0.05
144 0.03
145 0.03
146 0.03
147 0.02
148 0.02
149 0.02
150 0.03
151 0.03
152 0.04
153 0.05
154 0.05
155 0.07
156 0.11
157 0.12
158 0.18
159 0.21
160 0.26
161 0.29
162 0.32
163 0.41
164 0.44
165 0.5
166 0.47
167 0.48
168 0.47
169 0.49
170 0.49
171 0.44
172 0.46
173 0.46
174 0.46
175 0.45
176 0.43
177 0.44
178 0.42
179 0.37
180 0.31
181 0.24
182 0.21
183 0.19
184 0.16
185 0.12
186 0.12
187 0.1
188 0.1
189 0.16
190 0.17
191 0.16
192 0.17
193 0.23
194 0.25
195 0.25
196 0.26
197 0.24
198 0.29
199 0.33
200 0.36
201 0.32
202 0.38
203 0.39
204 0.38
205 0.36
206 0.33
207 0.33
208 0.31
209 0.31
210 0.24
211 0.24
212 0.27
213 0.28
214 0.27
215 0.26
216 0.24
217 0.23
218 0.25
219 0.26
220 0.29
221 0.28
222 0.28
223 0.35
224 0.4
225 0.4
226 0.42
227 0.42
228 0.4
229 0.41
230 0.43
231 0.33
232 0.31
233 0.29
234 0.24
235 0.24
236 0.18
237 0.17
238 0.22
239 0.23
240 0.26
241 0.32
242 0.4
243 0.48
244 0.59
245 0.69
246 0.71
247 0.8
248 0.86
249 0.91
250 0.94
251 0.93
252 0.93
253 0.93
254 0.92
255 0.89
256 0.84
257 0.78
258 0.75
259 0.75
260 0.67
261 0.58
262 0.55
263 0.54
264 0.56
265 0.61
266 0.64
267 0.62
268 0.68
269 0.67