Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4B2Q5

Protein Details
Accession D4B2Q5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
338-360EIEAYNQKNKRRKRGLDEASDFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
KEGG abe:ARB_02738  -  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MSLRPIEQALASLLPALAEDLPRELLNLASSLLTQTRSCGATLKPEMEIARPTLKLPSPLSRPPCPPRVYKKLYAYLEQSLQSSSVSSKRQGAEPQAQKRASARIQNKATAPPALPTPTATSSAISSPRQVKKTGDGRNNASSKLVTSSSPAVELPQWTMGQIRTICKTFPSLTRAKEIPSPSTFASTLPPHVYAGLCSVLSFISAAEGRLTEKWQDLVSPVLSLGTKQDDPKALEVTNKRVTTLSIAIYFVVYTRRIGMVYDADVQQYPNKPMTEVDEADMEETIGRALDSVGLPRVVNGREQYSMEVDAWLMIMLEMGWAIDQEWFENIPLPTADEIEAYNQKNKRRKRGLDEASDFEEDDDEILSPKRKMVKSRNADAGRRHLTSGEHNHCGDTLLPGLGTMMHPQVDWLSEDKRYSYGTWRDRIMMWIEQVEISG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.09
7 0.1
8 0.12
9 0.12
10 0.13
11 0.12
12 0.12
13 0.12
14 0.12
15 0.1
16 0.09
17 0.09
18 0.1
19 0.12
20 0.13
21 0.12
22 0.14
23 0.17
24 0.18
25 0.18
26 0.2
27 0.2
28 0.27
29 0.31
30 0.32
31 0.29
32 0.31
33 0.32
34 0.31
35 0.32
36 0.26
37 0.27
38 0.25
39 0.25
40 0.28
41 0.29
42 0.32
43 0.34
44 0.38
45 0.4
46 0.48
47 0.53
48 0.54
49 0.6
50 0.62
51 0.66
52 0.63
53 0.65
54 0.67
55 0.71
56 0.72
57 0.72
58 0.73
59 0.74
60 0.73
61 0.68
62 0.62
63 0.56
64 0.52
65 0.44
66 0.36
67 0.28
68 0.24
69 0.2
70 0.16
71 0.15
72 0.17
73 0.19
74 0.21
75 0.26
76 0.27
77 0.32
78 0.36
79 0.4
80 0.45
81 0.51
82 0.57
83 0.59
84 0.58
85 0.55
86 0.53
87 0.53
88 0.48
89 0.49
90 0.46
91 0.47
92 0.51
93 0.54
94 0.54
95 0.5
96 0.47
97 0.4
98 0.35
99 0.27
100 0.26
101 0.24
102 0.22
103 0.19
104 0.21
105 0.2
106 0.22
107 0.21
108 0.19
109 0.17
110 0.2
111 0.23
112 0.2
113 0.22
114 0.28
115 0.34
116 0.36
117 0.37
118 0.36
119 0.41
120 0.5
121 0.54
122 0.53
123 0.52
124 0.55
125 0.61
126 0.6
127 0.52
128 0.44
129 0.35
130 0.28
131 0.25
132 0.21
133 0.13
134 0.14
135 0.16
136 0.15
137 0.15
138 0.14
139 0.13
140 0.13
141 0.13
142 0.12
143 0.12
144 0.12
145 0.11
146 0.13
147 0.12
148 0.15
149 0.16
150 0.17
151 0.18
152 0.19
153 0.19
154 0.18
155 0.21
156 0.19
157 0.22
158 0.25
159 0.27
160 0.28
161 0.33
162 0.33
163 0.31
164 0.34
165 0.32
166 0.3
167 0.27
168 0.28
169 0.23
170 0.25
171 0.24
172 0.19
173 0.21
174 0.17
175 0.18
176 0.16
177 0.17
178 0.14
179 0.14
180 0.14
181 0.1
182 0.11
183 0.09
184 0.08
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.04
191 0.04
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.07
198 0.08
199 0.08
200 0.08
201 0.09
202 0.09
203 0.09
204 0.09
205 0.1
206 0.09
207 0.08
208 0.07
209 0.07
210 0.07
211 0.06
212 0.07
213 0.08
214 0.09
215 0.1
216 0.12
217 0.15
218 0.16
219 0.18
220 0.19
221 0.17
222 0.21
223 0.23
224 0.27
225 0.31
226 0.29
227 0.28
228 0.26
229 0.26
230 0.24
231 0.24
232 0.19
233 0.13
234 0.13
235 0.12
236 0.12
237 0.11
238 0.09
239 0.09
240 0.08
241 0.07
242 0.08
243 0.08
244 0.08
245 0.09
246 0.1
247 0.09
248 0.1
249 0.13
250 0.12
251 0.12
252 0.12
253 0.12
254 0.15
255 0.16
256 0.16
257 0.17
258 0.17
259 0.17
260 0.18
261 0.22
262 0.23
263 0.22
264 0.2
265 0.18
266 0.18
267 0.17
268 0.17
269 0.12
270 0.07
271 0.06
272 0.05
273 0.04
274 0.03
275 0.03
276 0.03
277 0.05
278 0.05
279 0.07
280 0.08
281 0.09
282 0.09
283 0.09
284 0.13
285 0.12
286 0.15
287 0.15
288 0.17
289 0.18
290 0.19
291 0.19
292 0.18
293 0.18
294 0.15
295 0.14
296 0.11
297 0.1
298 0.09
299 0.07
300 0.05
301 0.04
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.05
311 0.05
312 0.05
313 0.07
314 0.08
315 0.08
316 0.12
317 0.12
318 0.12
319 0.12
320 0.13
321 0.12
322 0.13
323 0.13
324 0.09
325 0.1
326 0.13
327 0.19
328 0.19
329 0.26
330 0.29
331 0.37
332 0.45
333 0.53
334 0.6
335 0.65
336 0.72
337 0.74
338 0.81
339 0.82
340 0.84
341 0.81
342 0.74
343 0.67
344 0.59
345 0.5
346 0.39
347 0.3
348 0.2
349 0.15
350 0.11
351 0.07
352 0.07
353 0.1
354 0.13
355 0.13
356 0.17
357 0.26
358 0.29
359 0.39
360 0.48
361 0.57
362 0.62
363 0.69
364 0.76
365 0.74
366 0.76
367 0.72
368 0.72
369 0.67
370 0.6
371 0.53
372 0.44
373 0.4
374 0.43
375 0.48
376 0.45
377 0.44
378 0.42
379 0.42
380 0.4
381 0.39
382 0.3
383 0.22
384 0.17
385 0.12
386 0.11
387 0.11
388 0.11
389 0.1
390 0.1
391 0.11
392 0.11
393 0.11
394 0.11
395 0.12
396 0.13
397 0.13
398 0.14
399 0.15
400 0.17
401 0.2
402 0.22
403 0.22
404 0.24
405 0.25
406 0.25
407 0.31
408 0.38
409 0.43
410 0.47
411 0.48
412 0.49
413 0.47
414 0.49
415 0.45
416 0.39
417 0.34
418 0.3
419 0.28