Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AWR2

Protein Details
Accession D4AWR2   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-39RAEADERASRERRKKKKKKKEQPTYHRRSQPPBasic
68-95HSPFSPLKKKEKQGIKKKRKEKERKEKKBasic
NLS Segment(s)
PositionSequence
15-30ASRERRKKKKKKKEQP
73-95PLKKKEKQGIKKKRKEKERKEKK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
KEGG abe:ARB_00628  -  
Amino Acid Sequences MSYTVSIRAEADERASRERRKKKKKKKEQPTYHRRSQPPIHPSHHQSDSRHRPFNLSKPDPQPIPSHHSPFSPLKKKEKQGIKKKRKEKERKEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.42
4 0.51
5 0.61
6 0.67
7 0.74
8 0.82
9 0.87
10 0.92
11 0.95
12 0.96
13 0.97
14 0.97
15 0.97
16 0.97
17 0.96
18 0.93
19 0.91
20 0.89
21 0.8
22 0.76
23 0.72
24 0.69
25 0.65
26 0.63
27 0.58
28 0.54
29 0.55
30 0.53
31 0.53
32 0.48
33 0.43
34 0.46
35 0.53
36 0.54
37 0.55
38 0.49
39 0.49
40 0.49
41 0.55
42 0.55
43 0.48
44 0.48
45 0.48
46 0.52
47 0.48
48 0.46
49 0.41
50 0.35
51 0.4
52 0.38
53 0.38
54 0.35
55 0.35
56 0.38
57 0.42
58 0.48
59 0.5
60 0.51
61 0.57
62 0.65
63 0.71
64 0.75
65 0.78
66 0.78
67 0.79
68 0.85
69 0.86
70 0.88
71 0.91
72 0.91
73 0.92
74 0.93
75 0.93