Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AIU2

Protein Details
Accession D4AIU2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-37SSSYPGPGCKERREREKKKRDTKLAGNRANAHydrophilic
NLS Segment(s)
PositionSequence
17-31ERREREKKKRDTKLA
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
KEGG abe:ARB_04190  -  
Amino Acid Sequences MARSDDSSSYPGPGCKERREREKKKRDTKLAGNRANAILTKGEEKTEERGRRIERDGDGDEGEEELAVELFALFAEEEEEEEEKKQEREEKVTAATSDGELLTKGSFLLYNGIGSFLLAGDPDIQICFVLEGMQIYPVCLDSSMVRPWNDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.51
4 0.57
5 0.66
6 0.75
7 0.82
8 0.85
9 0.9
10 0.92
11 0.92
12 0.94
13 0.93
14 0.9
15 0.9
16 0.9
17 0.89
18 0.85
19 0.76
20 0.68
21 0.59
22 0.51
23 0.41
24 0.31
25 0.22
26 0.16
27 0.17
28 0.15
29 0.14
30 0.15
31 0.16
32 0.21
33 0.29
34 0.33
35 0.32
36 0.38
37 0.4
38 0.43
39 0.45
40 0.44
41 0.36
42 0.36
43 0.35
44 0.31
45 0.28
46 0.23
47 0.2
48 0.15
49 0.13
50 0.07
51 0.05
52 0.04
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.03
63 0.03
64 0.03
65 0.04
66 0.05
67 0.05
68 0.06
69 0.07
70 0.08
71 0.08
72 0.1
73 0.16
74 0.17
75 0.22
76 0.24
77 0.25
78 0.25
79 0.26
80 0.25
81 0.2
82 0.18
83 0.12
84 0.11
85 0.09
86 0.08
87 0.06
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.08
96 0.07
97 0.08
98 0.08
99 0.09
100 0.08
101 0.08
102 0.08
103 0.05
104 0.05
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.11
126 0.1
127 0.11
128 0.1
129 0.14
130 0.2
131 0.24
132 0.24