Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B4M2

Protein Details
Accession D4B4M2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-49TTKYSYPKRPSAKERAKAKSKTHydrophilic
NLS Segment(s)
PositionSequence
35-48KRPSAKERAKAKSK
152-167GGGKPAKGKKKGKGKK
Subcellular Location(s) mito 12, cyto 8, cyto_nucl 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG abe:ARB_03412  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVYLATSQDYLKQSSLLLEAYPDSTRITTKYSYPKRPSAKERAKAKSKTAAPAPTETPEPTAVPATLTLKTFNPATGICLKYQTNKAAEVGRLIAGLGKLASGSPIEDFVPAPVPVKAAAGEAEDVDMPDATPSSAVDEISGSNTPVAGGGGGGKPAKGKKKGKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.15
4 0.12
5 0.11
6 0.11
7 0.13
8 0.13
9 0.12
10 0.12
11 0.12
12 0.14
13 0.14
14 0.17
15 0.17
16 0.23
17 0.33
18 0.41
19 0.51
20 0.56
21 0.63
22 0.68
23 0.75
24 0.77
25 0.77
26 0.78
27 0.77
28 0.8
29 0.8
30 0.81
31 0.77
32 0.73
33 0.71
34 0.64
35 0.61
36 0.57
37 0.54
38 0.47
39 0.46
40 0.43
41 0.35
42 0.34
43 0.28
44 0.24
45 0.2
46 0.18
47 0.15
48 0.14
49 0.12
50 0.1
51 0.11
52 0.11
53 0.11
54 0.12
55 0.12
56 0.11
57 0.13
58 0.13
59 0.11
60 0.11
61 0.09
62 0.12
63 0.15
64 0.16
65 0.15
66 0.17
67 0.18
68 0.2
69 0.23
70 0.23
71 0.19
72 0.19
73 0.2
74 0.2
75 0.19
76 0.17
77 0.14
78 0.11
79 0.1
80 0.09
81 0.08
82 0.06
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.09
98 0.09
99 0.1
100 0.09
101 0.09
102 0.09
103 0.1
104 0.09
105 0.07
106 0.08
107 0.08
108 0.08
109 0.07
110 0.08
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.08
122 0.08
123 0.08
124 0.08
125 0.09
126 0.09
127 0.12
128 0.13
129 0.1
130 0.09
131 0.09
132 0.09
133 0.08
134 0.08
135 0.05
136 0.05
137 0.07
138 0.07
139 0.1
140 0.11
141 0.11
142 0.15
143 0.23
144 0.32
145 0.4
146 0.47
147 0.54