Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AL04

Protein Details
Accession D4AL04    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-35EYWEENRAYKKRKLERRKNNPPKQRCFDWMHydrophilic
NLS Segment(s)
PositionSequence
15-27KKRKLERRKNNPP
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
KEGG abe:ARB_05000  -  
Amino Acid Sequences MGEIGEYWEENRAYKKRKLERRKNNPPKQRCFDWMITSGISYSKNRSSFKTYRHIRPVTLASGTGARVIGVGSVELKVPRSPDNPEVNTLILDVVLHIPGAICNGFSPQMLGGSTSFGDPLQGYNDDKQPSYYATTFCGLWRLVLDGNPEGETQLAEARRNGTMLWLSVYINEEDEERIFGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.53
3 0.58
4 0.69
5 0.79
6 0.82
7 0.85
8 0.89
9 0.94
10 0.95
11 0.96
12 0.95
13 0.94
14 0.93
15 0.9
16 0.84
17 0.78
18 0.74
19 0.68
20 0.63
21 0.55
22 0.47
23 0.4
24 0.34
25 0.29
26 0.23
27 0.21
28 0.17
29 0.18
30 0.22
31 0.28
32 0.3
33 0.33
34 0.41
35 0.44
36 0.48
37 0.54
38 0.56
39 0.59
40 0.67
41 0.64
42 0.56
43 0.55
44 0.52
45 0.44
46 0.38
47 0.29
48 0.2
49 0.19
50 0.18
51 0.14
52 0.1
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.07
65 0.09
66 0.12
67 0.13
68 0.17
69 0.23
70 0.3
71 0.3
72 0.31
73 0.3
74 0.28
75 0.26
76 0.22
77 0.15
78 0.08
79 0.07
80 0.05
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.03
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.05
96 0.06
97 0.06
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.06
107 0.06
108 0.08
109 0.1
110 0.11
111 0.14
112 0.19
113 0.19
114 0.2
115 0.2
116 0.19
117 0.19
118 0.22
119 0.21
120 0.17
121 0.18
122 0.2
123 0.19
124 0.18
125 0.19
126 0.15
127 0.13
128 0.13
129 0.13
130 0.12
131 0.14
132 0.17
133 0.15
134 0.16
135 0.16
136 0.16
137 0.14
138 0.13
139 0.11
140 0.09
141 0.12
142 0.13
143 0.14
144 0.16
145 0.18
146 0.18
147 0.19
148 0.18
149 0.17
150 0.17
151 0.16
152 0.17
153 0.16
154 0.15
155 0.16
156 0.19
157 0.16
158 0.15
159 0.14
160 0.13
161 0.13
162 0.14