Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AT73

Protein Details
Accession D4AT73    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-31MEFRRLENRYARRKNRHTLTYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto_nucl 7.5, cyto 5
Family & Domain DBs
KEGG abe:ARB_07437  -  
Amino Acid Sequences MGLKDKIEEIMEFRRLENRYARRKNRHTLTYGAQYVDGEYIYGPGSPAVSPSPSATTVRKQSTGGKSSKWGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.34
4 0.39
5 0.42
6 0.48
7 0.58
8 0.67
9 0.71
10 0.77
11 0.83
12 0.82
13 0.78
14 0.7
15 0.64
16 0.59
17 0.56
18 0.49
19 0.4
20 0.32
21 0.26
22 0.22
23 0.18
24 0.13
25 0.06
26 0.04
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.08
38 0.1
39 0.12
40 0.14
41 0.17
42 0.19
43 0.25
44 0.32
45 0.35
46 0.36
47 0.35
48 0.43
49 0.49
50 0.53
51 0.5
52 0.45
53 0.47