Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AKG9

Protein Details
Accession D4AKG9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-42NKLVGERRKKENKRGREKADVFBasic
NLS Segment(s)
PositionSequence
17-38KLKINKLVGERRKKENKRGREK
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
KEGG abe:ARB_04812  -  
Amino Acid Sequences MKLKQREMRLEMEMKLKLKINKLVGERRKKENKRGREKADVFPFIPFSAWAVAGAGETGINLLEHPSQIAALIDHSRLPSFSFCIYLPLSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.37
4 0.35
5 0.36
6 0.4
7 0.39
8 0.41
9 0.47
10 0.54
11 0.58
12 0.65
13 0.64
14 0.67
15 0.73
16 0.74
17 0.78
18 0.78
19 0.79
20 0.8
21 0.84
22 0.81
23 0.81
24 0.78
25 0.75
26 0.72
27 0.64
28 0.54
29 0.45
30 0.39
31 0.28
32 0.24
33 0.16
34 0.1
35 0.07
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.05
58 0.07
59 0.09
60 0.09
61 0.1
62 0.11
63 0.12
64 0.12
65 0.14
66 0.13
67 0.15
68 0.15
69 0.17
70 0.16
71 0.19
72 0.21