Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AZJ3

Protein Details
Accession D4AZJ3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-58NDLKEKKTAKERKLKQERNLVKWHydrophilic
NLS Segment(s)
PositionSequence
21-57GRARAQSKAGGSSRRNDLKEKKTAKERKLKQERNLVK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG abe:ARB_01611  -  
Amino Acid Sequences MRHTKQKRSKSNCIYYLEQKGRARAQSKAGGSSRRNDLKEKKTAKERKLKQERNLVKWFEEKERNEKEMSRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.71
3 0.72
4 0.66
5 0.63
6 0.55
7 0.53
8 0.51
9 0.52
10 0.47
11 0.4
12 0.41
13 0.4
14 0.39
15 0.39
16 0.38
17 0.39
18 0.38
19 0.39
20 0.4
21 0.39
22 0.4
23 0.4
24 0.45
25 0.45
26 0.53
27 0.54
28 0.52
29 0.57
30 0.64
31 0.67
32 0.69
33 0.71
34 0.73
35 0.8
36 0.83
37 0.8
38 0.82
39 0.82
40 0.8
41 0.79
42 0.7
43 0.62
44 0.59
45 0.55
46 0.53
47 0.54
48 0.5
49 0.52
50 0.57
51 0.56
52 0.54
53 0.53