Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AT13

Protein Details
Accession D4AT13   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-37HMRKTITEGKGKRRSRRSRNFFLFYIHydrophilic
NLS Segment(s)
PositionSequence
20-29GKGKRRSRRS
Subcellular Location(s) nucl 18.5, mito_nucl 12, mito 4.5, cyto 4
Family & Domain DBs
KEGG abe:ARB_07377  -  
Amino Acid Sequences MKKLRNTESPQHMRKTITEGKGKRRSRRSRNFFLFYILRREAANFFTYKAQFLSWRAKEDALRVVIKDIEEDMAEGECDIIQFWHLWEQHAERDRTKAWLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.52
4 0.49
5 0.52
6 0.53
7 0.6
8 0.68
9 0.74
10 0.75
11 0.77
12 0.81
13 0.83
14 0.88
15 0.86
16 0.87
17 0.88
18 0.83
19 0.72
20 0.67
21 0.6
22 0.51
23 0.49
24 0.38
25 0.3
26 0.25
27 0.26
28 0.22
29 0.19
30 0.19
31 0.12
32 0.13
33 0.16
34 0.16
35 0.15
36 0.14
37 0.13
38 0.12
39 0.16
40 0.23
41 0.21
42 0.24
43 0.25
44 0.26
45 0.26
46 0.27
47 0.28
48 0.22
49 0.21
50 0.18
51 0.18
52 0.18
53 0.17
54 0.15
55 0.11
56 0.08
57 0.08
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.04
65 0.04
66 0.05
67 0.04
68 0.05
69 0.05
70 0.06
71 0.12
72 0.13
73 0.15
74 0.19
75 0.21
76 0.29
77 0.37
78 0.39
79 0.35
80 0.4
81 0.4