Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4ALY9

Protein Details
Accession D4ALY9   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-154DEEIRPSRRVSPRKGKRVDYGBasic
NLS Segment(s)
PositionSequence
145-148PRKG
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
KEGG abe:ARB_05337  -  
Amino Acid Sequences MTSASAAKEGEGEERSIEAFRKTSINSNIYLPIQTVYQNKDLSSKLSKNTLLEEPSISDGINTDRGEYSKTGGDSEVASQRSAYDICYRDPADVRTASDREEEANGHRDRRPLEVSPANREVSRFTDEGGGQHDEEIRPSRRVSPRKGKRVDYGGADISSHPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.16
5 0.14
6 0.14
7 0.15
8 0.18
9 0.19
10 0.26
11 0.32
12 0.33
13 0.32
14 0.33
15 0.35
16 0.32
17 0.31
18 0.23
19 0.17
20 0.15
21 0.17
22 0.19
23 0.19
24 0.23
25 0.24
26 0.24
27 0.26
28 0.26
29 0.27
30 0.31
31 0.31
32 0.28
33 0.33
34 0.34
35 0.31
36 0.34
37 0.33
38 0.28
39 0.25
40 0.23
41 0.19
42 0.19
43 0.18
44 0.14
45 0.1
46 0.09
47 0.1
48 0.14
49 0.12
50 0.12
51 0.12
52 0.13
53 0.14
54 0.14
55 0.14
56 0.12
57 0.12
58 0.12
59 0.11
60 0.11
61 0.1
62 0.12
63 0.14
64 0.13
65 0.12
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.12
72 0.13
73 0.13
74 0.17
75 0.17
76 0.18
77 0.19
78 0.19
79 0.17
80 0.17
81 0.17
82 0.18
83 0.18
84 0.18
85 0.18
86 0.17
87 0.14
88 0.15
89 0.14
90 0.13
91 0.2
92 0.21
93 0.22
94 0.24
95 0.26
96 0.26
97 0.3
98 0.32
99 0.26
100 0.33
101 0.37
102 0.38
103 0.42
104 0.44
105 0.41
106 0.37
107 0.36
108 0.31
109 0.27
110 0.29
111 0.22
112 0.19
113 0.21
114 0.21
115 0.22
116 0.23
117 0.22
118 0.17
119 0.18
120 0.2
121 0.15
122 0.18
123 0.24
124 0.23
125 0.24
126 0.25
127 0.34
128 0.41
129 0.49
130 0.57
131 0.61
132 0.69
133 0.77
134 0.83
135 0.8
136 0.79
137 0.78
138 0.72
139 0.67
140 0.61
141 0.54
142 0.47
143 0.42
144 0.34