Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AJ34

Protein Details
Accession D4AJ34    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-35KLELKLKLEEEKKKKKKTKKRKGLKFPFAEFIBasic
NLS Segment(s)
PositionSequence
12-28EEEKKKKKKTKKRKGLK
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
KEGG abe:ARB_04282  -  
Amino Acid Sequences MKLKLELKLKLEEEKKKKKKTKKRKGLKFPFAEFISPRLKSHAADSADKGVSLCSFSSSPASTSSFLLLPLPCLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.77
4 0.84
5 0.87
6 0.9
7 0.91
8 0.92
9 0.92
10 0.93
11 0.94
12 0.95
13 0.95
14 0.94
15 0.89
16 0.81
17 0.76
18 0.65
19 0.56
20 0.45
21 0.38
22 0.33
23 0.27
24 0.24
25 0.21
26 0.21
27 0.19
28 0.21
29 0.24
30 0.22
31 0.23
32 0.24
33 0.25
34 0.24
35 0.24
36 0.21
37 0.15
38 0.12
39 0.12
40 0.1
41 0.09
42 0.09
43 0.1
44 0.13
45 0.14
46 0.14
47 0.16
48 0.19
49 0.17
50 0.18
51 0.19
52 0.16
53 0.16
54 0.18
55 0.15