Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4ALX5

Protein Details
Accession D4ALX5    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MKRQREDSEQRLKKKKKKKQNKQKAVKRWRVVPRTLBasic
NLS Segment(s)
PositionSequence
11-30RLKKKKKKKQNKQKAVKRWR
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
KEGG abe:ARB_05323  -  
Amino Acid Sequences MKRQREDSEQRLKKKKKKKQNKQKAVKRWRVVPRTLCKQADLTASERRPARRPDSQTAAEKKQKKGYEDVSEWLGSLLACLLVLDTDRQTDRQLVDEVVFIYLFLIYRNAGRDSELFGLPTQTDRRGPGAPPQAAARPDRPSSRHYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.91
5 0.93
6 0.93
7 0.95
8 0.96
9 0.96
10 0.96
11 0.96
12 0.96
13 0.95
14 0.89
15 0.87
16 0.86
17 0.82
18 0.79
19 0.78
20 0.76
21 0.75
22 0.77
23 0.68
24 0.59
25 0.54
26 0.49
27 0.43
28 0.37
29 0.31
30 0.31
31 0.31
32 0.33
33 0.35
34 0.35
35 0.37
36 0.41
37 0.43
38 0.44
39 0.5
40 0.52
41 0.56
42 0.57
43 0.59
44 0.59
45 0.6
46 0.59
47 0.57
48 0.55
49 0.55
50 0.54
51 0.48
52 0.48
53 0.46
54 0.45
55 0.41
56 0.38
57 0.33
58 0.3
59 0.27
60 0.21
61 0.16
62 0.09
63 0.07
64 0.05
65 0.03
66 0.03
67 0.02
68 0.02
69 0.02
70 0.03
71 0.04
72 0.04
73 0.06
74 0.06
75 0.07
76 0.09
77 0.11
78 0.11
79 0.13
80 0.14
81 0.13
82 0.13
83 0.13
84 0.13
85 0.11
86 0.1
87 0.07
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.07
95 0.1
96 0.11
97 0.11
98 0.13
99 0.13
100 0.17
101 0.19
102 0.18
103 0.17
104 0.15
105 0.17
106 0.15
107 0.18
108 0.17
109 0.18
110 0.2
111 0.21
112 0.25
113 0.26
114 0.27
115 0.32
116 0.39
117 0.37
118 0.37
119 0.38
120 0.39
121 0.4
122 0.43
123 0.39
124 0.36
125 0.4
126 0.45
127 0.45