Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D4AY92

Protein Details
Accession D4AY92    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-91SKKAALWSKIRLKKKRKRAEEAKKPPEKAKBasic
NLS Segment(s)
PositionSequence
49-91RRGRPKFDPAANTSKKAALWSKIRLKKKRKRAEEAKKPPEKAK
Subcellular Location(s) cyto 12, mito 6, cyto_nucl 6, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG abe:ARB_01161  -  
Amino Acid Sequences MVFGDGEVGDVRRRRRSLAGWLAGWLAGWLAGWLAGLYIFIIIILRQIRRGRPKFDPAANTSKKAALWSKIRLKKKRKRAEEAKKPPEKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.43
4 0.49
5 0.54
6 0.54
7 0.46
8 0.45
9 0.42
10 0.35
11 0.3
12 0.2
13 0.1
14 0.05
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.05
31 0.06
32 0.06
33 0.11
34 0.13
35 0.19
36 0.29
37 0.33
38 0.37
39 0.41
40 0.48
41 0.5
42 0.52
43 0.52
44 0.47
45 0.53
46 0.51
47 0.48
48 0.42
49 0.37
50 0.33
51 0.32
52 0.31
53 0.27
54 0.31
55 0.37
56 0.46
57 0.53
58 0.63
59 0.69
60 0.76
61 0.79
62 0.85
63 0.87
64 0.87
65 0.89
66 0.91
67 0.92
68 0.93
69 0.94
70 0.94
71 0.92