Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AME5

Protein Details
Accession D4AME5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MMVVKKKKKKEKKKEGEGGEGGBasic
NLS Segment(s)
PositionSequence
5-19KKKKKKEKKKEGEGG
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
KEGG abe:ARB_05398  -  
Amino Acid Sequences MMVVKKKKKKEKKKEGEGGEGGEEGPFIRGFERRGSVQSGKGLPPPAAASRRPAAGHRAVLSVLSQLGSDKSVSTCQPTPLRPCPILEARQRLLEAFLTCPRAAPGTLAANLPGDTPYKLQTIRLNGCFYSLYCSFTSSSSPKHAALEMYIFSAPTDSIARSQLICVSLSPPDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.9
3 0.88
4 0.79
5 0.7
6 0.59
7 0.48
8 0.37
9 0.27
10 0.2
11 0.11
12 0.1
13 0.07
14 0.07
15 0.08
16 0.1
17 0.12
18 0.17
19 0.2
20 0.2
21 0.23
22 0.29
23 0.3
24 0.31
25 0.35
26 0.33
27 0.32
28 0.33
29 0.32
30 0.26
31 0.25
32 0.24
33 0.24
34 0.25
35 0.24
36 0.25
37 0.25
38 0.27
39 0.27
40 0.26
41 0.26
42 0.27
43 0.28
44 0.25
45 0.24
46 0.21
47 0.2
48 0.19
49 0.14
50 0.1
51 0.07
52 0.06
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.09
60 0.09
61 0.13
62 0.14
63 0.18
64 0.21
65 0.24
66 0.3
67 0.33
68 0.37
69 0.34
70 0.33
71 0.33
72 0.34
73 0.37
74 0.35
75 0.35
76 0.32
77 0.32
78 0.32
79 0.27
80 0.24
81 0.19
82 0.15
83 0.12
84 0.13
85 0.15
86 0.15
87 0.15
88 0.14
89 0.13
90 0.13
91 0.11
92 0.11
93 0.11
94 0.12
95 0.12
96 0.12
97 0.12
98 0.12
99 0.11
100 0.09
101 0.08
102 0.08
103 0.09
104 0.11
105 0.13
106 0.13
107 0.16
108 0.19
109 0.26
110 0.31
111 0.34
112 0.34
113 0.31
114 0.32
115 0.3
116 0.26
117 0.24
118 0.19
119 0.19
120 0.16
121 0.18
122 0.18
123 0.18
124 0.23
125 0.2
126 0.23
127 0.25
128 0.28
129 0.27
130 0.28
131 0.29
132 0.25
133 0.24
134 0.23
135 0.18
136 0.17
137 0.16
138 0.14
139 0.13
140 0.12
141 0.1
142 0.1
143 0.11
144 0.1
145 0.12
146 0.14
147 0.15
148 0.15
149 0.16
150 0.18
151 0.17
152 0.17
153 0.16
154 0.16