Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AK31

Protein Details
Accession D4AK31   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
75-110DQGAACKTAREKKKKQKKKKKQRWKGREAEEKEKATBasic
NLS Segment(s)
PositionSequence
83-112AREKKKKQKKKKKQRWKGREAEEKEKATRE
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG abe:ARB_04632  -  
Amino Acid Sequences MLEWSPQRRPWPSISLPVNQPDPCAGKVVSPMSVLSDGEKACCSLIVRVLYTPKQLTSQTHDSTKPTPSLYVDVDQGAACKTAREKKKKQKKKKKQRWKGREAEEKEKATRETQKKNSTMRAQGERLCKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.52
4 0.52
5 0.52
6 0.44
7 0.4
8 0.34
9 0.33
10 0.28
11 0.27
12 0.22
13 0.18
14 0.22
15 0.23
16 0.2
17 0.17
18 0.17
19 0.16
20 0.16
21 0.15
22 0.12
23 0.14
24 0.12
25 0.13
26 0.13
27 0.11
28 0.1
29 0.11
30 0.1
31 0.08
32 0.13
33 0.13
34 0.13
35 0.14
36 0.18
37 0.18
38 0.2
39 0.2
40 0.16
41 0.17
42 0.18
43 0.19
44 0.22
45 0.28
46 0.27
47 0.3
48 0.3
49 0.3
50 0.31
51 0.31
52 0.25
53 0.19
54 0.18
55 0.16
56 0.17
57 0.16
58 0.15
59 0.14
60 0.12
61 0.13
62 0.12
63 0.11
64 0.08
65 0.08
66 0.06
67 0.07
68 0.11
69 0.18
70 0.28
71 0.37
72 0.48
73 0.58
74 0.7
75 0.8
76 0.88
77 0.91
78 0.94
79 0.96
80 0.97
81 0.97
82 0.97
83 0.97
84 0.97
85 0.96
86 0.94
87 0.93
88 0.92
89 0.88
90 0.87
91 0.83
92 0.76
93 0.69
94 0.63
95 0.55
96 0.5
97 0.53
98 0.52
99 0.55
100 0.6
101 0.67
102 0.7
103 0.74
104 0.78
105 0.75
106 0.75
107 0.73
108 0.71
109 0.67
110 0.66