Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4B341

Protein Details
Accession D4B341    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKLKERERKSKERQDKTDEDLBasic
NLS Segment(s)
PositionSequence
67-75KKREEKREK
Subcellular Location(s) nucl 18, cyto_nucl 12, cyto 4, mito 2
Family & Domain DBs
KEGG abe:ARB_02875  -  
Amino Acid Sequences MKLKERERKSKERQDKTDEDLLMDCEEDDDDEDDEEDEEDEEDDDEKMLMTKMKSYGQEEEEEEEAKKREEKREKEQEEKAGRRSSDAAASVPWLAPEAEALRPLKSCLKPSLPGNKRQTQQTAGEAEKTQDAEQDAESCWLRQCWSTCKAQAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.79
4 0.76
5 0.65
6 0.56
7 0.46
8 0.39
9 0.3
10 0.24
11 0.17
12 0.1
13 0.1
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.08
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.08
37 0.08
38 0.1
39 0.12
40 0.16
41 0.19
42 0.21
43 0.24
44 0.23
45 0.25
46 0.24
47 0.24
48 0.21
49 0.2
50 0.17
51 0.15
52 0.14
53 0.13
54 0.17
55 0.18
56 0.26
57 0.35
58 0.41
59 0.49
60 0.59
61 0.63
62 0.65
63 0.66
64 0.65
65 0.63
66 0.6
67 0.55
68 0.49
69 0.43
70 0.38
71 0.37
72 0.29
73 0.23
74 0.21
75 0.16
76 0.12
77 0.13
78 0.12
79 0.1
80 0.09
81 0.07
82 0.06
83 0.05
84 0.06
85 0.07
86 0.07
87 0.1
88 0.11
89 0.11
90 0.12
91 0.14
92 0.21
93 0.22
94 0.25
95 0.28
96 0.31
97 0.35
98 0.41
99 0.51
100 0.48
101 0.55
102 0.6
103 0.61
104 0.6
105 0.62
106 0.6
107 0.54
108 0.52
109 0.48
110 0.45
111 0.39
112 0.38
113 0.33
114 0.3
115 0.27
116 0.25
117 0.2
118 0.17
119 0.18
120 0.16
121 0.16
122 0.17
123 0.15
124 0.17
125 0.18
126 0.17
127 0.17
128 0.17
129 0.18
130 0.21
131 0.25
132 0.29
133 0.33
134 0.39