Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AST0

Protein Details
Accession D4AST0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-126EVPPDLREIRRQQRKRDKEKKKKEQAVQBasic
NLS Segment(s)
PositionSequence
108-121RRQQRKRDKEKKKK
Subcellular Location(s) cysk 11, cyto 9.5, cyto_mito 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
Gene Ontology GO:0006744  P:ubiquinone biosynthetic process  
KEGG abe:ARB_07295  -  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MQRYRECHDFYHAVTDLPIVVEGELALKIFEFMNTGLPMTGLAAAAVVRLKGAERERFWDIHLPWAVRSGAKSKELICVYWEEMLERDVGEIRAELGIEVPPDLREIRRQQRKRDKEKKKKEQAVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.18
4 0.15
5 0.14
6 0.07
7 0.06
8 0.06
9 0.05
10 0.06
11 0.06
12 0.05
13 0.05
14 0.04
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.09
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.08
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.04
38 0.08
39 0.12
40 0.17
41 0.18
42 0.22
43 0.25
44 0.25
45 0.26
46 0.29
47 0.25
48 0.26
49 0.27
50 0.23
51 0.21
52 0.23
53 0.22
54 0.16
55 0.16
56 0.14
57 0.15
58 0.16
59 0.17
60 0.16
61 0.22
62 0.22
63 0.22
64 0.19
65 0.18
66 0.18
67 0.19
68 0.18
69 0.12
70 0.12
71 0.12
72 0.11
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.07
89 0.09
90 0.1
91 0.11
92 0.18
93 0.28
94 0.38
95 0.49
96 0.56
97 0.66
98 0.76
99 0.85
100 0.89
101 0.91
102 0.91
103 0.92
104 0.96
105 0.96
106 0.96