Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D4AZR4

Protein Details
Accession D4AZR4   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-66SQAISKSPNKPKKAPRQKDEERRLRAHydrophilic
NLS Segment(s)
PositionSequence
46-70KSPNKPKKAPRQKDEERRLRAFRSK
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007527  Znf_SWIM  
IPR039903  Zswim2  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
KEGG abe:ARB_01682  -  
Pfam View protein in Pfam  
PF04434  SWIM  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MKRKRQADTTSDQPGPARRARKIQAVPRGAGVIEGTGEAASQAISKSPNKPKKAPRQKDEERRLRAFRSKPPQTYLVKLFVLRRTRGGTEEVPEEYIDIAGSTGNIYQVVIGKEPSCTCPDAKKGNQCKHVVYVGSMLQENPYIFKSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.44
4 0.43
5 0.4
6 0.48
7 0.51
8 0.58
9 0.61
10 0.64
11 0.67
12 0.65
13 0.61
14 0.54
15 0.5
16 0.4
17 0.32
18 0.23
19 0.13
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.08
32 0.11
33 0.19
34 0.3
35 0.39
36 0.44
37 0.52
38 0.61
39 0.7
40 0.79
41 0.8
42 0.76
43 0.78
44 0.82
45 0.85
46 0.85
47 0.84
48 0.79
49 0.75
50 0.72
51 0.66
52 0.64
53 0.58
54 0.56
55 0.57
56 0.57
57 0.54
58 0.54
59 0.56
60 0.5
61 0.49
62 0.43
63 0.37
64 0.3
65 0.29
66 0.29
67 0.28
68 0.3
69 0.27
70 0.27
71 0.26
72 0.26
73 0.26
74 0.28
75 0.23
76 0.2
77 0.22
78 0.2
79 0.17
80 0.16
81 0.15
82 0.11
83 0.1
84 0.07
85 0.05
86 0.04
87 0.03
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.08
96 0.09
97 0.09
98 0.1
99 0.1
100 0.13
101 0.14
102 0.16
103 0.16
104 0.17
105 0.18
106 0.23
107 0.3
108 0.37
109 0.43
110 0.51
111 0.59
112 0.66
113 0.73
114 0.7
115 0.66
116 0.62
117 0.59
118 0.49
119 0.41
120 0.35
121 0.29
122 0.28
123 0.25
124 0.21
125 0.17
126 0.19
127 0.17
128 0.16
129 0.16